9rai

Structure of the S.aureus MecA/ClpC/ClpP degradation system

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adapter protein MecA

Staphylococcus aureus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	unknown substrate × 1 ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2G0P5） ATP-dependent Clp protease proteolytic subunit × 14 （Q2G036） ADENOSINE-5'-DIPHOSPHATE × 4 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 6 MAGNESIUM ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MECA_STAA3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–239； UniProt 1–239 Author chain B； PDBConstruct 1–239； UniProt 1–239 Author chain C； PDBConstruct 1–239； UniProt 1–239 Author chain D； PDBConstruct 1–239； UniProt 1–239 Author chain E； PDBConstruct 1–239； UniProt 1–239 Author chain F； PDBConstruct 1–239； UniProt 1–239

ATP-dependent Clp protease ATP-binding subunit ClpC

Staphylococcus aureus

UniProt Q2G0P5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Adapter protein MecA × 6 （Q2FI79） unknown substrate × 1 ATP-dependent Clp protease proteolytic subunit × 14 （Q2G036） ADENOSINE-5'-DIPHOSPHATE × 4 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 6 MAGNESIUM ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CLPC_STAA8
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain a； PDBConstruct 1–818； UniProt 1–818 Author chain b； PDBConstruct 1–818； UniProt 1–818 Author chain c； PDBConstruct 1–818； UniProt 1–818 Author chain d； PDBConstruct 1–818； UniProt 1–818 Author chain e； PDBConstruct 1–818； UniProt 1–818 Author chain f； PDBConstruct 1–818； UniProt 1–818

ATP-dependent Clp protease proteolytic subunit

Staphylococcus aureus

UniProt Q2G036

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Adapter protein MecA × 6 （Q2FI79） unknown substrate × 1 ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2G0P5） ADENOSINE-5'-DIPHOSPHATE × 4 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 6 MAGNESIUM ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CLPP_STAA8
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–195； UniProt 1–195 Author chain H； PDBConstruct 1–195； UniProt 1–195 Author chain I； PDBConstruct 1–195； UniProt 1–195 Author chain J； PDBConstruct 1–195； UniProt 1–195 Author chain K； PDBConstruct 1–195； UniProt 1–195 Author chain L； PDBConstruct 1–195； UniProt 1–195 Author chain M； PDBConstruct 1–195； UniProt 1–195 Author chain N； PDBConstruct 1–195； UniProt 1–195 Author chain O； PDBConstruct 1–195； UniProt 1–195 Author chain P； PDBConstruct 1–195； UniProt 1–195 Author chain Q； PDBConstruct 1–195； UniProt 1–195 Author chain R； PDBConstruct 1–195； UniProt 1–195 Author chain T； PDBConstruct 1–195； UniProt 1–195 Author chain U； PDBConstruct 1–195； UniProt 1–195

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rai
Deposition date deposition_date	2025-05-20
Structure title title	Structure of the S.aureus MecA/ClpC/ClpP degradation system
Keywords keywords	protein-quality control, AAA+ unfoldases, peptidases, adaptor proteins, CHAPERONE; CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rai__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rai__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rai__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.39 Å
Rg (electron density)	74.80 Å
Total Rg	74.61 Å
Atom count	60975
Residues	7728
Excluded volume	1085300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rai__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Adapter protein MecA
Molecular weight formula_weight	28354.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	60975

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	unknown substrate
Molecular weight formula_weight	1549.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

XXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit ClpC
Molecular weight formula_weight	91170.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f

MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVIEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTVDHDGKEFKYDIAEQTSETKTPSQA

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	ATP-dependent Clp protease proteolytic subunit
Molecular weight formula_weight	21536.5 kDa
EC 编号 ec_number	3.4.21.92
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L,M,N,O,P,Q,R,T,U

MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	7

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	82854

Structure of the S.aureus MecA/ClpC/ClpP degradation system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adapter protein MecA

State in the Current Structure

Other States of the Same Protein in the Database

ATP-dependent Clp protease ATP-binding subunit ClpC

State in the Current Structure

Other States of the Same Protein in the Database

ATP-dependent Clp protease proteolytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rai__assembly_1__model_1

9rai__assembly_1__model_1 | I(q)

9rai__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Structure of the S.aureus MecA/ClpC/ClpP degradation system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adapter protein MecA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent Clp protease ATP-binding subunit ClpC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent Clp protease proteolytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rai__assembly_1__model_1

9rai__assembly_1__model_1 | I(q)

9rai__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)