9rce

Cryo-EM structure of a contractile injection system in Salmonella enterica subspecies Salamae, the baseplate portion in extended state.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidoglycan-binding protein

Salmonella enterica subsp. salamae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 43	Conserved hypothetical phage tail region protein × 6 （A0A379QYS5） SalCis12 × 6 GPW/gp25 family protein × 6 Phage tail sheath family protein × 6 SalCis6 × 3 Type VI secretion system tip protein VgrG × 3 SalCis10 × 1 （A0A379R0X0） Baseplate protein J-like domain-containing protein × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A730ZGQ3_SALHO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain H； PDBConstruct 1–217； UniProt 1–217 Author chain M； PDBConstruct 1–217； UniProt 1–217

Conserved hypothetical phage tail region protein

Salmonella enterica subsp. salamae

UniProt A0A379QYS5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 43	Peptidoglycan-binding protein × 6 （A0A730ZGQ3） SalCis12 × 6 GPW/gp25 family protein × 6 Phage tail sheath family protein × 6 SalCis6 × 3 Type VI secretion system tip protein VgrG × 3 SalCis10 × 1 （A0A379R0X0） Baseplate protein J-like domain-containing protein × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A379QYS5_SALER
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–158； UniProt 1–158 Author chain N； PDBConstruct 1–158； UniProt 1–158

SalCis10

Salmonella enterica subsp. salamae

UniProt A0A379R0X0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 43	Peptidoglycan-binding protein × 6 （A0A730ZGQ3） Conserved hypothetical phage tail region protein × 6 （A0A379QYS5） SalCis12 × 6 GPW/gp25 family protein × 6 Phage tail sheath family protein × 6 SalCis6 × 3 Type VI secretion system tip protein VgrG × 3 Baseplate protein J-like domain-containing protein × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A379R0X0_SALER
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain c； PDBConstruct 1–99； UniProt 1–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rce
Deposition date deposition_date	2025-05-28
Structure title title	Cryo-EM structure of a contractile injection system in Salmonella enterica subspecies Salamae, the baseplate portion in extended state.
Keywords keywords	contractile injection system Salmonella, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rce__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rce__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rce__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.52 Å
Rg (electron density)	86.87 Å
Total Rg	86.95 Å
Atom count	298965
Residues	18868
Excluded volume	2678100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rce__assembly_1__model_1`	43-meric （43）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Peptidoglycan-binding protein
Molecular weight formula_weight	23868.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,M
Atom count atom_count	100103

MEKITIKSITSKGTVAQTFSATLNPNSIKHNFGISYTDKGPQQQGDISPTTVFKGYESEKLDFELLFDGTGVTGSTSTNTVQKQLATLKKVTYAYNGEQHEPNPVVIAWGSSVNFQGRLTAISINYSLFDSSGNPLRATVSLSFAKYLTQQEKSALKKQSSPDLTHIIEFKAGDTLPMLCHKIYNDSSYYIDVARANNLVSARQITPGTKIYFPPLI

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Conserved hypothetical phage tail region protein
Molecular weight formula_weight	17506.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,N

MVTAKGSGAAQGDGDWPLPAFYFSVSISGCADDTAFQEVSGLEFQIETEEYREGGNNLVYHLPKTIKSSNLTLKRAVTDKASRLLSWCLDILNDELSKPIQTKSVSINLLNEKGTTCKSWTASNAYPVKLKMAPFNSTQNDIAIEEIEICFHHLKRNL

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	SalCis12
Molecular weight formula_weight	93034.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,J

MPAHSDWGVNSTMSKTISKKDHNDNPNSFGHLYQLGLTYIQQLSGHLWTDYNTHDPGMTILEQVCYALTDLIYRCEFEVTDYLSEPSGNIDYRAHGLALAEDIIPSYPQQPKEYEAWLLARLPELDKVWLRNSENDSHLGIYTLNAQLNHFYALSQQRAVTGKHSVYTQQYAALHRIRHEYYRVRAVGEDLAAIELTGQHPLSLSAVIHISDDVADVTWLAACIYHRIHLWLESNQQNTPVNVIKESLLAEDGILQIDRLEFMQHSDNVSHDEQKAIDNIAPFSYLMLPEASAHSGIEIVQFQHPVNIDYADLAIQIEQIQYQQRNAQLKTPTPPALPVGQYVDFTRYESIQTLFPRNYHLAPGTPIQYHAQQQAQRHQLRSYLLLFDQLMANFCDDIAGLNALFSLSLTPEVTYHAHSLQDDEFYNIEKHYPRDANAGLERLRAQLDNYPERKNRIFNYLLALYSERYPDWLHRQFNPYFSTQTLEKEILKYKQAFILNIVTMTNGRGIGDNLLQPEHQGGYCQRLALLLGLFPSVDAAKGNVRTFARYSLNLVSDQDYFHSDTGRKALWLTTLEAQTSLQPIEENALTGYPKESDIHDTLLTAPLFREKILPDALLQFGIDNHRYRLLSRQNHDVHQLFFHVDIDGHKRWFHIASHSDKQALILLCHQLQRWLVQLNRDSEELYVVEPILLRTEATSASLSDYANRVILVLPGYTARFSNLRFREQVEQLIVENSPAHLLTQCLWLDFAMFNQFETLYTQWRQAKSNALQHKERQPECDATAQRLYLFLQRASIGADGVESQ

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	GPW/gp25 family protein
Molecular weight formula_weight	16921.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,K

MANDNTFLGTGWAFPPRFTGPNHQVVMSSDMQDIEQSLTLLLSTTPGERLMTPDFGCRINQFVFEELTQTVLTQLSSEIRHAILFFESRIDVEDVHFLPEPLSGKLLIQIDYSVITTNTRSNMVYPFYLNEGTLISPQLLPLANEWDIA

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	57351.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,L

MGVMKTPGVYIVEQNAFPNSVVEVATAVPAFIGYTEKADNGGKSLSNKGWRITSMSEYRQYFGGEPQHLFEISEISTTSNANIREAFKQSGKTYQITQSNTRHHLYYSMLFFFQNGGGPCYIVSVGNYSDDIDAAVLKGGILPLIKEAEPTMLLIPEAIQLAEDDCINVEQAMLGHCGGKMKNRVAILDVWNGYKDRQHPDGDCVESFRSKLGTHYLDYAAAYYPWLNTSIVQDSDVSFLNISNIDKLAELLSGEVALMFSDLEGLSEEELSTGGNKLRATRKQAMLDEIAKLSAEISRPDAVLLHKILSNMSPLYQTIMADIKFQQNILPPSSAMAGIYTMVDNSRGVWKAPANVSVNAVVSPTVNISDDEQEDLNVTTQGKSINAIRPFIGEGTLVWGARTLDGNSVDWRYINVRRTMIMLEESIKLASKAYVFEPNVANTWVSMESMLSNFLYGIWKRGGLAGSTPGEAYNVSVGLGKTMTSNDILEGILRITVLVAMVRPAEFIEITFQQKMQES

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	SalCis6
Molecular weight formula_weight	6294.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

VPLEIKQLVIKSQTINDDNKSPSFGSDWPGIESEESVSAKVIPYPFMPSPDEVRER

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Type VI secretion system tip protein VgrG
Molecular weight formula_weight	63170.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAISPLSNNSTGVTTYTIKVGGKAIDSAIGVIAIHIHYQVNHIATAEITISDGDMPTQRFDISDADTFKPGSTISISAGYASDEQTIFDGIIISHGIEIAANNSSSLSVICKDQAVAMTIAKHSQCFLGKSDSKIISTLLANYPNITASVGRITDPHSELVQFNSTDWDFILTRAEANGFVVTNQSNKVTVDKPAISNAADLVVTYGTDLISFSAKVDARNQLKSVTATAWDPAKQSMVTGTGPAQSISGQGNLTSSELAKVLGISDYTLQTASTLSTDSLTRWADGQQVKAMLSKVRGSVTFQGNASATINSLIELAGVGERYNGSHYISGVHHSIEKGQWITTAELGMSPMWSADHRDIGAPPASGYLPPVDGLQIGVVTKLDGDPESNYRIQIKIPTLNSEANVIWARLASYYASSGFGNFFIPEVGDEVIVGCINQDPSNPIILGSLYSSKNKMPEEMTSDNYIKTLVTKSKMKIIFDDENSVMTLKTPNGNTVVISDKNKSITLADQNSNTICMDKNGIAITSSKDVMISAKGGVNISSTRDTIVKATGDAKISGLNISAQANTGLTLKGTATAELSCSGITTVKGALVKIN

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	SalCis10
Molecular weight formula_weight	9573.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MPFAARITDLQMCPMSTPGLPPIPHVGGPIIGPGVPTVLIGSLPAAVVGDSCVCVGPPSTIVKGSATVLIGGKPAARMGDTTSHGGSITIGCPTVIIGG

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Baseplate protein J-like domain-containing protein
Molecular weight formula_weight	150611.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G

MTSRQQRQDEAINSSLFHPHELSFEQLVGWAHQFAQQLPFRNLQDQADGHWGNLFQKSEIVVCAAISTSDTKHIQRQFKQALAHDENVTVEFLLILLKRLQAWYQHLPGAPETAYQFKYYLLHEYQRHLSLPLSLVICRLPEQFRHSVQELDPLWNLDQHTLDTASPVLQHSSFTEQMRHCFAKIVFVIEQIKKQSQQVLQAALMHQENNPQQALYFAFLKLFERAQQSLNQFTEKHLQFYYRQVLQQEKQSARENAVYLKLSLNHPTSSSIQFEQGAKFSPGDDPDFKPIAYRSRYPIEVTDAEVSHVFNLTLQRDPLVSPEKESGLVCGVSGQRVQITAGATGDDFPKAQQFNIFNNKYKTEDSTQPMGLIISDPLFSMQQGKRVIEIIVHLKEVRSSIVAQELLVVDDNNKTSAALTHIFAQLLSLHVHLFEDWAARITASGLTKQISQEQLSQFRQLRPSQRVWVAYKLFYLQTLQYICSTPEKGMQYGLSKIDLLFRIVGQMVSRRCLYTSAWLTKTDISTALSGLKSILVADPTAYTTIEELLSHSTTAAFYQIFQGGFDIEATTENGWELIDNVEIYPCPPQECQIGFKVKCHIDTGFAPIIPRLAHLPHSASLKITLKRQSNCFPYAIFRDFELSKLAMSTQVCGVTQLQLFNPEGQVDSSQPFFLFGSQPYMDAYVVLANEEIARKSISQLSLHLDWGNLPRGSDGFKQHYAEYHYPYTNASFQMRAEVLNNGRWVEFGPTGFSLFTPASGALRHDSHLHFLNMRNGYTPVTRPWPKTPYSNQSGLRNGLFKLLLTGPEPAFGHKDYAPLLSDTLTYNVTKKHKKTLPNQPYTPLVTHISIDYSAESTIDLLSVDRRSQSEIIHLYPFGENIIYPPKQTSPVHRPRFFPNYKEDSHCFIGITARELSGYLNIFFVFDGSARLVMPYPSTSYRWYYLVDNEWQALNPHQIIHDTTLNFLTTGIVTLDLPSEINTDHSVMPSGLFWLRVSTNKGIDRYPDCLHVATHVVKVTGKGVPLADDGITPLSFSSWRSTPRKANLAAIAQLNAMIRIPDIESEQHFQMRVSENLRHKGKALTPWDYEHLILENFPEVGSVHCFPTRSYYSLNQEPGRVLIIVTPLNTDCDHSLCSPKQLDSSYLLAIRRFLLSVSRSHVQIEVRNPGYEKIQIRCKVTLKEGVSHGPALRRLEYAIKAQLCPWEADTLNTGPGFCLSLEKLSAFILKQKNVVKVSALSALKISLDENTEYVLQDSAATSQPIRAAYPWFLLIPEEHQYIQISPDNLSHKPVTVGIGELVIGEQFIVSTSPTSPPKGAQNNG

Source Source

Source organism organism	Salmonella enterica subsp. salamae
NCBI taxonomy ID ncbi_taxonomy_id	59202
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.86 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	20065

Cryo-EM structure of a contractile injection system in Salmonella enterica subspecies Salamae, the baseplate portion in extended state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidoglycan-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Conserved hypothetical phage tail region protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SalCis10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rce__assembly_1__model_1

9rce__assembly_1__model_1 | I(q)

9rce__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 polymer

Polymer Polymer

Source Source

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source

7. Citations (1)