← Back to search

9s9c

Crystal structure of the apo BRL2 ectodomain from Arabidopsis thaliana.

Method: X-RAY DIFFRACTION D_max: 104.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9s9c
deposition_date	2025-08-06
last_revision	2025-09-03
title	Crystal structure of the apo BRL2 ectodomain from Arabidopsis thaliana.
keywords	receptor kinase, steroid receptor, brassinosteroids, leucine-rich repeat, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	33.97 Å
rg_electron	33.31 Å
i0	79810800.00
molecular_weight	72295.0 kDa
excluded_volume	90935 Å³
envelope_volume	123650 Å³
shell_volume	31080 Å³
envelope_diameter	108.3 Å
shell_rg	40.28 Å
envelope_rg	32.18 Å
shape_rg	33.29 Å
total_rg	33.94 Å
total_atoms	10137
n_residues	650
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	104.3 Å
rg_real	33.96 Å
rg_real_error	0.79 Å
i0_real	7.9810e+07
i0_real_error	1.2860e+06
rg_reciprocal	33.97 Å
i0_reciprocal	79810000.0000
total_estimate	0.8769
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	51.1 Å
skewness	0.142
kurtosis	-0.811
angular_range	— – 0.2350 Å⁻¹
current_alpha	0.0000
highest_alpha	19160000.0000
n_real_points	48
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.908; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.901; Smooth: 0.770

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Serine/threonine-protein kinase BRI1-like 2
formula_weight	81155.8 kDa
ec_number	2.7.11.1
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	10147

MTTSPIRVRIRTRIQISFIFLLTHLSQSSSSDQSSLKTDSLSLLSFKTMIQDDPNNILSNWSPRKSPCQFSGVTCLGGRVTEINLSGSGLSGIVSFNAFTSLDSLSVLKLSENFFVLNSTSLLLLPLTLTHLELSSSGLIGTLPENFFSKYSNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGNSISGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRLGRQPGSKALSGLLSGNTMAFVRNVGNSCKGVGGLVEFSGIRPERLLQIPSLKSCDFTRMYSGPILSLFTRYQTIEYLDLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNELTGPIPQRGQLSTLPATQYANNPGLCGVPLPECKNGNNQAAAENLYFQ

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Trichoplusia ni

Entity 2 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	424.4 kDa
src_method	man
entity_count	1

Entity 3 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	570.5 kDa
src_method	man
entity_count	1

Entity 4 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	4

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	10

▶

6. Citations (2)

▶

length_a	118.613 Å
length_b	118.613 Å
length_c	155.623 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 41 21 2
int_tables_number	92
crystal_system	tetragonal

resolution	2.590 Å
resolution_low	47.530 Å
r_factor	0.2687
r_work	0.2674
r_free	0.2919

fit	/app/data/saxs_computation/s9/9s9c/9s9c.fit
pddf	/app/data/pr_computation/s9/9s9c/9s9c.pr.out
profile	/app/data/saxs_computation/s9/9s9c/9s9c.dat