9swn

Cryo-EM structure of yeast telomerase holoenzyme

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomere replication protein EST3

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Telomere elongation protein EST1 × 1 （P17214） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） TLC1 RNA × 1 Telomerase reverse transcriptase × 1 （Q06163） ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EST3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–181； UniProt 1–181

Ribonucleases P/MRP protein subunit POP6

OrganismNot specified

UniProt P53218

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Telomere replication protein EST3 × 1 （Q03096） Telomere elongation protein EST1 × 1 （P17214） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） TLC1 RNA × 1 Telomerase reverse transcriptase × 1 （Q06163） ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP6_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–158； UniProt 1–158

Telomere elongation protein EST1

Saccharomyces cerevisiae

UniProt P17214

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Telomere replication protein EST3 × 1 （Q03096） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） TLC1 RNA × 1 Telomerase reverse transcriptase × 1 （Q06163） ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EST1_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–699； UniProt 1–699

Ribonucleases P/MRP protein subunit POP7

OrganismNot specified

UniProt P38291

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Telomere replication protein EST3 × 1 （Q03096） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Telomere elongation protein EST1 × 1 （P17214） Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） TLC1 RNA × 1 Telomerase reverse transcriptase × 1 （Q06163） ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP7_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–140； UniProt 1–140

Ribonucleases P/MRP protein subunit POP1

OrganismNot specified

UniProt P41812

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Telomere replication protein EST3 × 1 （Q03096） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Telomere elongation protein EST1 × 1 （P17214） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） TLC1 RNA × 1 Telomerase reverse transcriptase × 1 （Q06163） ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–875； UniProt 1–875

Telomerase reverse transcriptase

Saccharomyces cerevisiae

UniProt Q06163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Telomere replication protein EST3 × 1 （Q03096） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Telomere elongation protein EST1 × 1 （P17214） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） TLC1 RNA × 1 ZINC ION × 2 MAGNESIUM ION × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TERT_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–884； UniProt 1–884

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9swn
Deposition date deposition_date	2025-10-07
Structure title title	Cryo-EM structure of yeast telomerase holoenzyme
Keywords keywords	Telomerase, Telomerase RNA, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9swn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9swn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9swn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.11 Å
Rg (electron density)	61.15 Å
Total Rg	61.37 Å
Atom count	25945
Residues	2804
Excluded volume	447790 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9swn__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Telomere replication protein EST3
Molecular weight formula_weight	20577.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	25947

MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYKYL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	Ribonucleases P/MRP protein subunit POP6
Molecular weight formula_weight	18235.0 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ

Entity 3 Entity 3 polymer

Description description	Telomere elongation protein EST1
Molecular weight formula_weight	81920.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDNEEVNEECMRLFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHRKSTRFLEELLLKQENMYHNNNYERINDSVIPLVLKLLWLQIHEPTLQWFEHWFHDIMRLSNRRKFRVFRIFQKKMIQFFKITHRYYYDIIEHLCAKYDMNSVISNALFAKLNLMQYTDGLSTHEKIILNTSNPLTFSIVISLQRCVINLGSTHFYKTLLNKPSNKPKSVEGFEKSIRYLNIASLYLPAVGDTYFQRAKIYLITGKFSLYFFELVRGALVRIPSKCALNNLKDFILTPDFPERRRLMKKLAILVSKDLKGEKSFFEGQIVLQFLSIVEHTLVPQSWNASRASNCWLLKEHLQMAALKYHSGNINVILENLAATMGSFDLMFTTRKSKEQKNKLKYADLSERQVFFLDLSFDFIANIIDVVIKPSWQKNMEDFRYLAIIRLLMCWIKSYRSILQYTHRHRKFCTSFALLLNDLINSPLNCSGNIYSHRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKVLSPKEECVLRIRSIIFSGMKFLEKNDTGVIWNASKYKFDLISPNIKIKRQIALSEISSKINVKTQQERVVSSRKVEAKRDEQQRKRAGKIAVTELEKQFANVRRTKKLSPLPEKDGVSSELVKHAASRGRKTITGPLSSDFLSYPDEAIDADEDITVQVPDTPT

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	Ribonucleases P/MRP protein subunit POP7
Molecular weight formula_weight	15844.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGQADIDMESDVEDDDKETQLKKRAVSGVELRIYV

Entity 5 Entity 5 polymer

Description description	Ribonucleases P/MRP protein subunit POP1
Molecular weight formula_weight	100559.6 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSGSLSRGNGGKKVLNKNQLLKRNRIRNARSIRAEAVAASSTKTGTPSDLSESGSKLNVDQFISSRQFEVKQLQLAMHNSKAASSTRIFQALPRKLRRRTASHNVRRIPKRMRNRALREMRKSDQQDVLKGSSASSRKAHGLNAKQLYKARMSIKLLRLASKSTSMKLSMPPEVTSSNCHVRQKIKTLKRMIKESSTANPNIKLLNNRMGSYDCTGVNELAPIPKGRVKYTKRQKHFAWLPTHIWNAKRSHMMKRWGYQMVWAPTQKCFKLTHRLGGDTCSSDGALCMDSSYIGTIIVKDKSNDSEGDFLKSIIGKLTAERANLRKYREGQVLFQGLIYSFNEENGEDSTKPLGPCDVFWVQKDTAIIRLHPSIYTQVFNILLQHKEKLTVQDCRYSLASVTLKGAKALESLASCLRSTEYSKSFEQFKMVSMITDHNALPQRCTFAFEAIDPRHLAAPKKLNDSQRKTVNSDDILSLHENYPQDEINAVFNELCDPESRTQSYNNQNTLKEISARRYKLLTATPNSINKTTVPFKESDDPSIPLVIIRRLKTRDWIVVLPWFWLLPLWHLLNRIPRMYHIGLRQFQQIQYENKQLYFPDDYPFTQLGYIENSFYKKEASKTKWDRKPMGKRINFEKIKDIHNTKLPAYSGEIGDFFSSDWRFLQILRNGIDYLQRNDKTLELMDSKKTGQFNAQGVRDINCVNDVLEFCKDYEAKTKAMSLSIEENIPVALCKNRKCQFRTPDSISVNSSSFSLTFFPRCIIAVSCTLLERGHPKDNARIYQVPEKDLEHWLQLAKGVYRPNGRKDHDLKIPLPEVHDLIGFITSGTYHLNCGNGMGIGFIDHHAAIRQPTRYVLIRNVGTNTYRLGEWSKISV

Entity 6 Entity 6 polymer

Description description	TLC1 RNA
Molecular weight formula_weight	370246.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GAGAGGAAGAUAGGUACCCUAUGAAAAUGUCAAUGGCUGUUGCGUUUGCUUAAUCGUAUUUUUUUUUUUUUCAGUCCGUGUUUUUUGUACAUUCUACGUUUGAGUUUUCCAUCAUGCAGGCCUCAGAAAUUUGGUAGGCACUCGAUGGUGAAGAGAUAGUGUCGGAUUUCGGAUUGAUCUUUCAGUUGAUAGCCUGCUGCUCUUUUCUUUUCCAAAGAAUUUCGAGUAUGCUGGUGUCAGUGUAGAUGCUUGUGUGUGCGCAAUUUGUGGUUUUUUAUUGUGUUUCUACUUAUAGAUGGCUAAAAUCUGAGUUUAGAAAAUGCAAACCGUAAAUUCUUAAACACUGCUAUUGCAUUUAGUUGCUAAAGCAGUGUUUUUGAACUUAUUCCUGUUAUUCCUUCUUCGUACCGAUCCUCUUCUCGACCUAACCUUUUAAUUACCAUGGGAAGCCUACCAUCACCACACCCACACACAAAUGUUACAGCUAAUUGUUUAUUAGCAAAGUUUGCACGAGUUCGCUGUUUAUUUUUUUCUCGUUUUCUUAUACCUAGUAUUUUUUCUGACACUGUUUAAGGUGACAGAAAAAAAGGAGUUUAAGUUAGAUUUGCAAACAGACGGUGCUAAGCGCUGUCACUUUAUGUCUAUCUUAUCGUUAACUCUGGAAAAAGAAAAAGGAAAAAGAACGUCAGGGAACAUGAGUAUAUAUAGAAAUGGUUUAUUCUAGUUUUUUCCGUUUUUUCAGUAGAUUUUUGCCUUUAAAAGAAUAAAUCCCACUACAAAAAGGUAAAAUAAAAAAUCUAUUCACUGAACUUACUGAUGAAAUUUCCAAAUGUGCCCCGUACAUCGAACGAUGUGACAGAGAAAAAUACGAGUAGGUAAAUAAGCCAAAAGGCAAGGGUGUCCUUUCUUAAGCAUCGGUUAGGUUUGCGGGCGAUCAGUAACUGAACAAUGACACAAGAUCAAGAACGUAAUUUGAGAUUUUUCAAGAUGGUUUUUUUAGGUAUCUAUUAAAACUACUUUGAUGAUCAAUACGGUAUUUUUGUCGCAUUAUUUUCCAAGCGGAAGGAACCGUGUGUUCAUUUUAUGAAUCUUGGUGUUGUAUUCACAGCUACUUCUCCUAAUGCCUUCGAUGCAUUUAGAUAAUUUUUGGAAACAUU

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Telomerase reverse transcriptase
Molecular weight formula_weight	102768.1 kDa
EC 编号 ec_number	2.7.7.49
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MKILFEFIQDKLDIDLQTNSTYKENLKCGHFNGLDEILTTCFALPNSRKIALPCLPGDLSHKAVIDHCIIYLLTGELYNNVLTFGYKIARNEDVNNSLFCHSANVNVTLLKGAAWKMFHSLVGTYAFVDLLINYTVIQFNGQFFTQIVGNRCNEPHLPPKWAQRSSSSSATAAQIKQLTEPVTNKQFLHKLNINSSSFFPYSKILPSSSSIKKLTDLREAIFPTNLVKIPQRLKVRINLTLQKLLKRHKRLNYVSILNSICPPLEGTVLDLSHLSRQSPKERVLKFIIVILQKLLPQEMFGSKKNKGKIIKNLNLLLSLPLNGYLPFDSLLKKLRLKDFRWLFISDIWFTKHNFENLNQLAICFISWLFRQLIPKIIQTFFYCTEISSTVTIVYFRHDTWNKLITPFIVEYFKTYLVENNVCRNHNSYTLSNFNHSKMRIIPKKSNNEFRIIAIPCRGADEEEFTIYKENHKNAIQPTQKILEYLRNKRPTSFTKIYSPTQIADRIKEFKQRLLKKFNNVLPELYFMKFDVKSCYDSIPRMECMRILKDALKNENGFFVRSQYFFNTNTGVLKLFNVVNASRVPKPYELYIDNVRTVHLSNQDVINVVEMEIFKTALWVEDKCYIREDGLFQGSSLSAPIVDLVYDDLLEFYSEFKASPSQDTLILKLADDFLIISTDQQQVINIKKLAMGGFQKYNAKANRDKILAVSSQSDDDTVIQFCAMHIFVKELEVWKHSSTMNNFHIRSKSSKGIFRSLIALFNTRISYKTIDTNLNSTNTVLMQIDHVVKNISECYKSAFKDLSINVTQNMQFHSFLQRIIEMTVSGCPITKCDPLIEYEVRFTILNGFLESLSSNTSKFKDNIILLRKEIQHLQAYIYIYIHIVN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	233.020 Å
R factor r_factor	—
R_work r_work	0.3294
R_free r_free	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	125104

Cryo-EM structure of yeast telomerase holoenzyme

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomere replication protein EST3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomere elongation protein EST1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase reverse transcriptase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9swn__assembly_1__model_1

9swn__assembly_1__model_1 | I(q)

9swn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 non-polymer