SAXSdb — 9t3f

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RACB protein

Hordeum vulgare

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	RIPb from Hordeum vulgare × 1 （F2D8Y4） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8RW50_HORVU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–200； UniProt 1–197

RIPb from Hordeum vulgare

Hordeum vulgare

UniProt F2D8Y4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	RACB protein × 1 （Q8RW50） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2D8Y4_HORVV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–30； UniProt 525–554

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9t3f
Deposition date deposition_date	2025-10-27
Structure title title	RACB with GSP and the fragment of RIPb protein bound (parallel)
Keywords keywords	RACB, Hordeum vulgare, GSP, RIPb, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9t3f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9t3f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9t3f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.05 Å
Rg (electron density)	16.94 Å
Total Rg	17.97 Å
Atom count	1637
Residues	208
Excluded volume	29166 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9t3f__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	RACB protein
Molecular weight formula_weight	21809.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1699

GSGMSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPYYIECSSKTQLNVKGVFDAAIKVVLQPPKAKKKKKAQRGACSIL

Source Source

Source organism organism	Hordeum vulgare
NCBI taxonomy ID ncbi_taxonomy_id	4513
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	RIPb from Hordeum vulgare
Molecular weight formula_weight	3230.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TEADAELRRLRVQSDQWRKAAEAAAAALAG

Source Source

Source organism organism	Hordeum vulgare
NCBI taxonomy ID ncbi_taxonomy_id	4513
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE
Molecular weight formula_weight	539.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	51

▶

Unit-cell length a length_a	64.000 Å
Unit-cell length b length_b	64.000 Å
Unit-cell length c length_c	243.320 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 61 2 2
Space-group number int_tables_number	178
Crystal system crystal_system	—

Resolution resolution	2.070 Å
Low-resolution limit resolution_low	45.800 Å
R factor r_factor	0.2075
R_work r_work	0.2055
R_free r_free	0.2469

RACB with GSP and the fragment of RIPb protein bound (parallel)

1. Protein Identity and Related Structures Protein Identity & Related Structures

RACB protein

State in the Current Structure

Other States of the Same Protein in the Database

RIPb from Hordeum vulgare

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9t3f__assembly_1__model_1

9t3f__assembly_1__model_1 | I(q)

9t3f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

RACB with GSP and the fragment of RIPb protein bound (parallel)

1. Protein Identity and Related Structures Protein Identity & Related Structures

RACB protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIPb from Hordeum vulgare

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9t3f__assembly_1__model_1

9t3f__assembly_1__model_1 | I(q)

9t3f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)