← Back to search

9t4n

Structure of the Q318A mutant of the SUN4 domain from Saccharomyces cerevisiae

Method: X-RAY DIFFRACTION D_max: 60.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9t4n
deposition_date	2025-10-30
title	Structure of the Q318A mutant of the SUN4 domain from Saccharomyces cerevisiae
keywords	cell wall, carbohydrate-binding, thaumatin-like domain, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.33 Å
rg_electron	18.13 Å
i0	17321500.00
molecular_weight	29999.0 kDa
excluded_volume	36782 Å³
envelope_volume	42309 Å³
shell_volume	19276 Å³
envelope_diameter	61.1 Å
shell_rg	24.60 Å
envelope_rg	18.39 Å
shape_rg	18.11 Å
total_rg	19.06 Å
total_atoms	4040
n_residues	282
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	60.9 Å
rg_real	19.22 Å
rg_real_error	0.31 Å
i0_real	1.7320e+07
i0_real_error	1.8660e+05
rg_reciprocal	19.24 Å
i0_reciprocal	17320000.0000
total_estimate	0.8941
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	60.0 Å
skewness	0.180
kurtosis	-0.388
angular_range	— – 0.4100 Å⁻¹
current_alpha	0.0000
highest_alpha	3128000.0000
n_real_points	72
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.892; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.946

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Probable secreted beta-glucosidase SUN4
formula_weight	31136.7 kDa
ec_number	3.2.1.-
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	4728

MGSSHHHHHHSSGLVPRGSHNGSIYGDLADFSGPYEKFEDGTIPCGQFPSGQGVIPISWLDEGGWSGVENTDTSTGGSCKEGSYCSYACQPGMSKTQWPSDQPSDGRSIGGLLCKDGYLYRSNTDTDYLCEWGVDAAYVVSELSNDVAICRTDYPGTENMVIPTYVQAGDSLPLTVVDQDTYYTWQGLKTSAAYYVNNAGISVEDACVWGSSSSGVGNWAPLNFGAGSSDGVAYLSLIPNPNNGNALNFNVKIVAADDSSTVNGECIYENGSFSGGSDGCTVSVTAGKAKFVLYN

Source

organism	Saccharomyces cerevisiae S288C
ncbi_taxonomy_id	559292
host_organism	Escherichia coli

Entity 2 non-polymer

description	HEXAETHYLENE GLYCOL
formula_weight	282.3 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	364

▶

6. Citations (1)

▶

length_a	62.400 Å
length_b	99.230 Å
length_c	102.210 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	I 2 2 2
int_tables_number	23
crystal_system	orthorhombic

resolution	1.280 Å
resolution_low	29.220 Å
r_factor	0.1428
r_work	0.1411
r_free	0.1684

fit	/app/data/saxs_computation/t4/9t4n/9t4n.fit
pddf	/app/data/pr_computation/t4/9t4n/9t4n.pr.out
profile	/app/data/saxs_computation/t4/9t4n/9t4n.dat

Structure of the Q318A mutant of the SUN4 domain from Saccharomyces cerevisiae

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction