← Back to search

9t4o

Structure of the E283A mutant of the SUN4 domain from Saccharomyces cerevisiae

Method: X-RAY DIFFRACTION D_max: 61.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9t4o
deposition_date	2025-10-30
title	Structure of the E283A mutant of the SUN4 domain from Saccharomyces cerevisiae
keywords	cell wall protein, beta-glucan, thaumatin, CARBOHYDRATE; CARBOHYDRATE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.36 Å
rg_electron	18.12 Å
i0	17539800.00
molecular_weight	30091.0 kDa
excluded_volume	36902 Å³
envelope_volume	42655 Å³
shell_volume	19402 Å³
envelope_diameter	61.4 Å
shell_rg	24.61 Å
envelope_rg	18.40 Å
shape_rg	18.11 Å
total_rg	19.09 Å
total_atoms	4051
n_residues	282
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	61.0 Å
rg_real	19.24 Å
rg_real_error	0.24 Å
i0_real	1.7540e+07
i0_real_error	1.9240e+05
rg_reciprocal	19.26 Å
i0_reciprocal	17540000.0000
total_estimate	0.8979
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.0 Å
skewness	0.180
kurtosis	-0.393
angular_range	— – 0.4100 Å⁻¹
current_alpha	0.0000
highest_alpha	3298000.0000
n_real_points	72
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.892; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.995

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Probable secreted beta-glucosidase SUN4
formula_weight	31135.7 kDa
ec_number	3.2.1.-
mutation	E283A
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	4809

MGSSHHHHHHSSGLVPRGSHNGSIYGDLADFSGPYEKFEDGTIPCGQFPSGQGVIPISWLDEGGWSGVENTDTSTGGSCKEGSYCSYACQPGMSKTQWPSDQPSDGRSIGGLLCKDGYLYRSNTDTDYLCEWGVDAAYVVSELSNDVAICRTDYPGTANMVIPTYVQAGDSLPLTVVDQDTYYTWQGLKTSAQYYVNNAGISVEDACVWGSSSSGVGNWAPLNFGAGSSDGVAYLSLIPNPNNGNALNFNVKIVAADDSSTVNGECIYENGSFSGGSDGCTVSVTAGKAKFVLYN

Source

organism	Saccharomyces cerevisiae S288C
ncbi_taxonomy_id	559292
host_organism	Escherichia coli

Entity 2 non-polymer

description	HEXAETHYLENE GLYCOL
formula_weight	282.3 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	385

▶

6. Citations (1)

▶

length_a	62.330 Å
length_b	99.090 Å
length_c	101.530 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	I 2 2 2
int_tables_number	23
crystal_system	orthorhombic

resolution	1.240 Å
resolution_low	29.740 Å
r_factor	0.1321
r_work	0.1305
r_free	0.1562

fit	/app/data/saxs_computation/t4/9t4o/9t4o.fit
pddf	/app/data/pr_computation/t4/9t4o/9t4o.pr.out
profile	/app/data/saxs_computation/t4/9t4o/9t4o.dat