← Back to search

9thx

G14 variant of 57aBi scaffold crystallized in I212121

Method: X-RAY DIFFRACTION D_max: 63.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9thx
deposition_date	2025-12-04
last_revision	2026-05-13
title	G14 variant of 57aBi scaffold crystallized in I212121
keywords	protein-protein recognition, ribosome display, IL-10, cytokine, PROTEIN BINDING; PROTEIN BINDING
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	18.13 Å
rg_electron	16.94 Å
i0	5043600.00
molecular_weight	15760.0 kDa
excluded_volume	19587 Å³
envelope_volume	25027 Å³
shell_volume	13321 Å³
envelope_diameter	63.4 Å
shell_rg	21.90 Å
envelope_rg	17.54 Å
shape_rg	16.89 Å
total_rg	18.03 Å
total_atoms	1104
n_residues	138
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	63.7 Å
rg_real	18.14 Å
rg_real_error	0.51 Å
i0_real	5.0440e+06
i0_real_error	6.8260e+04
rg_reciprocal	18.14 Å
i0_reciprocal	5044000.0000
total_estimate	0.7913
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	20.7 Å
skewness	0.346
kurtosis	-0.249
angular_range	— – 0.4400 Å⁻¹
current_alpha	0.0000
highest_alpha	665700.0000
n_real_points	75
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.778; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.949; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	PIH1 domain-containing protein 1
formula_weight	16956.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1346

MAHHHHHHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRSLVIRIALSGLEWKYSLWLFPAWVMMKNRPFMGSISQQNIR

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	2

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	193

▶

6. Citations (1)

▶

length_a	70.701 Å
length_b	72.230 Å
length_c	79.238 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	I 21 21 21
int_tables_number	24
crystal_system	—

resolution	1.364 Å
resolution_low	39.650 Å
r_factor	—
r_work	0.1782
r_free	0.2103

fit	/app/data/saxs_computation/th/9thx/9thx.fit
pddf	/app/data/pr_computation/th/9thx/9thx.pr.out
profile	/app/data/saxs_computation/th/9thx/9thx.dat

G14 variant of 57aBi scaffold crystallized in I212121

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction