← Back to search

9tia

G14 variant of 57aBi scaffold crystallized in P6422

Method: X-RAY DIFFRACTION D_max: 59.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tia
deposition_date	2025-12-05
last_revision	2026-05-13
title	G14 variant of 57aBi scaffold crystallized in P6422
keywords	protein-protein recognition, ribosome display, IL-10, cytokine, PROTEIN BINDING; PROTEIN BINDING
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	17.58 Å
rg_electron	16.36 Å
i0	4381460.00
molecular_weight	15006.0 kDa
excluded_volume	18846 Å³
envelope_volume	23399 Å³
shell_volume	12787 Å³
envelope_diameter	60.1 Å
shell_rg	21.39 Å
envelope_rg	17.04 Å
shape_rg	16.34 Å
total_rg	17.44 Å
total_atoms	1052
n_residues	132
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	59.2 Å
rg_real	17.59 Å
rg_real_error	0.39 Å
i0_real	4.3810e+06
i0_real_error	5.4060e+04
rg_reciprocal	17.59 Å
i0_reciprocal	4381000.0000
total_estimate	0.7988
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	18.1 Å
skewness	0.344
kurtosis	-0.234
angular_range	— – 0.4550 Å⁻¹
current_alpha	0.0000
highest_alpha	642900.0000
n_real_points	76
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.808; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.955; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	PIH1 domain-containing protein 1
formula_weight	16956.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1103

MAHHHHHHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRSLVIRIALSGLEWKYSLWLFPAWVMMKNRPFMGSISQQNIR

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	TRIETHYLENE GLYCOL
formula_weight	150.2 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	40

▶

6. Citations (1)

▶

length_a	71.976 Å
length_b	71.976 Å
length_c	108.713 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 64 2 2
int_tables_number	181
crystal_system	—

resolution	2.070 Å
resolution_low	41.001 Å
r_factor	0.2250
r_work	0.2215
r_free	0.2869

fit	/app/data/saxs_computation/ti/9tia/9tia.fit
pddf	/app/data/pr_computation/ti/9tia/9tia.pr.out
profile	/app/data/saxs_computation/ti/9tia/9tia.dat

G14 variant of 57aBi scaffold crystallized in P6422

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction