9tic

Phage 812 baseplate in the pre-contraction state (C3)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF68

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7P9_BPPGK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–458； UniProt 1–458 Author chain 8； PDBConstruct 1–458； UniProt 1–458 Author chain 9； PDBConstruct 1–458； UniProt 1–458 Author chain w； PDBConstruct 1–458； UniProt 1–458 Author chain x； PDBConstruct 1–458； UniProt 1–458 Author chain y； PDBConstruct 1–458； UniProt 1–458

ORF64

OrganismNot specified

UniProt Q6Y7Q3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q3_BPPGK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–173； UniProt 1–173 Author chain P； PDBConstruct 1–173； UniProt 1–173 Author chain Q； PDBConstruct 1–173； UniProt 1–173 Author chain R； PDBConstruct 1–173； UniProt 1–173 Author chain S； PDBConstruct 1–173； UniProt 1–173 Author chain T； PDBConstruct 1–173； UniProt 1–173 Author chain U； PDBConstruct 1–173； UniProt 1–173 Author chain V； PDBConstruct 1–173； UniProt 1–173 Author chain W； PDBConstruct 1–173； UniProt 1–173 Author chain X； PDBConstruct 1–173； UniProt 1–173 Author chain Y； PDBConstruct 1–173； UniProt 1–173 Author chain Z； PDBConstruct 1–173； UniProt 1–173 Author chain e； PDBConstruct 1–173； UniProt 1–173 Author chain f； PDBConstruct 1–173； UniProt 1–173 Author chain g； PDBConstruct 1–173； UniProt 1–173 Author chain h； PDBConstruct 1–173； UniProt 1–173 Author chain i； PDBConstruct 1–173； UniProt 1–173 Author chain j； PDBConstruct 1–173； UniProt 1–173 Author chain k； PDBConstruct 1–173； UniProt 1–173 Author chain l； PDBConstruct 1–173； UniProt 1–173 Author chain m； PDBConstruct 1–173； UniProt 1–173 Author chain n； PDBConstruct 1–173； UniProt 1–173 Author chain o； PDBConstruct 1–173； UniProt 1–173 Author chain p； PDBConstruct 1–173； UniProt 1–173

ORF65

OrganismNot specified

UniProt Q6Y7Q2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q2_BPPGK
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–1152； UniProt 1–1152 Author chain 3； PDBConstruct 1–1152； UniProt 1–1152 Author chain 4； PDBConstruct 1–1152； UniProt 1–1152 Author chain 5； PDBConstruct 1–1152； UniProt 1–1152 Author chain 6； PDBConstruct 1–1152； UniProt 1–1152 Author chain 7； PDBConstruct 1–1152； UniProt 1–1152 Author chain q； PDBConstruct 1–1152； UniProt 1–1152 Author chain r； PDBConstruct 1–1152； UniProt 1–1152 Author chain s； PDBConstruct 1–1152； UniProt 1–1152 Author chain t； PDBConstruct 1–1152； UniProt 1–1152 Author chain u； PDBConstruct 1–1152； UniProt 1–1152 Author chain v； PDBConstruct 1–1152； UniProt 1–1152

ORF58

OrganismNot specified

UniProt Q6Y7Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q9_BPPGK
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–848； UniProt 1–848

CBM-cenC domain-containing protein

OrganismNot specified

UniProt A0A0U1UXW5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXW5_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AA； PDBConstruct 1–640； UniProt 1–640 Author chain AB； PDBConstruct 1–640； UniProt 1–640 Author chain a； PDBConstruct 1–640； UniProt 1–640 Author chain b； PDBConstruct 1–640； UniProt 1–640 Author chain c； PDBConstruct 1–640； UniProt 1–640 Author chain z； PDBConstruct 1–640； UniProt 1–640

ORF50

OrganismNot specified

UniProt Q6Y7R7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R7_BPPGK
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AC； PDBConstruct 1–142； UniProt 1–142 Author chain AD； PDBConstruct 1–142； UniProt 1–142 Author chain AE； PDBConstruct 1–142； UniProt 1–142 Author chain AF； PDBConstruct 1–142； UniProt 1–142 Author chain AG； PDBConstruct 1–142； UniProt 1–142 Author chain AH； PDBConstruct 1–142； UniProt 1–142

ORF49

OrganismNot specified

UniProt Q6Y7R8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R8_BPPGK
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AI； PDBConstruct 1–587； UniProt 1–587 Author chain AJ； PDBConstruct 1–587； UniProt 1–587 Author chain AK； PDBConstruct 1–587； UniProt 1–587 Author chain AL； PDBConstruct 1–587； UniProt 1–587 Author chain AM； PDBConstruct 1–587； UniProt 1–587 Author chain AN； PDBConstruct 1–587； UniProt 1–587

ORF57

OrganismNot specified

UniProt Q6Y7R0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R0_BPPGK
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–295； UniProt 1–295

ORF56

OrganismNot specified

UniProt Q6Y7R1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R1_BPPGK
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–808； UniProt 1–808

ORF60

OrganismNot specified

UniProt Q6Y7Q7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q7_BPPGK
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–174； UniProt 1–174 Author chain E； PDBConstruct 1–174； UniProt 1–174

ORF59

OrganismNot specified

UniProt Q6Y7Q8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q8_BPPGK
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain F； PDBConstruct 1–263； UniProt 1–263 Author chain G； PDBConstruct 1–263； UniProt 1–263

ORF61

OrganismNot specified

UniProt Q6Y7Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q6_BPPGK
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain H； PDBConstruct 1–234； UniProt 1–234 Author chain I； PDBConstruct 1–234； UniProt 1–234

ORF62

OrganismNot specified

UniProt Q6Y7Q5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF63 × 6 （Q6Y7Q4） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q5_BPPGK
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 1–348； UniProt 1–348 Author chain K； PDBConstruct 1–348； UniProt 1–348 Author chain L； PDBConstruct 1–348； UniProt 1–348 Author chain M； PDBConstruct 1–348； UniProt 1–348

ORF63

OrganismNot specified

UniProt Q6Y7Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF67 × 3 （Q6Y7Q0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q4_BPPGK
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–1019； UniProt 1–1019 Author chain O； PDBConstruct 1–1019； UniProt 1–1019

ORF67

OrganismNot specified

UniProt Q6Y7Q0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 228	ORF68 × 18 （Q6Y7P9） ORF64 × 72 （Q6Y7Q3） ORF65 × 36 （Q6Y7Q2） ORF58 × 3 （Q6Y7Q9） CBM-cenC domain-containing protein × 18 （A0A0U1UXW5） ORF50 × 18 （Q6Y7R7） ORF49 × 18 （Q6Y7R8） ORF57 × 3 （Q6Y7R0） ORF56 × 3 （Q6Y7R1） ORF60 × 6 （Q6Y7Q7） ORF59 × 6 （Q6Y7Q8） ORF61 × 6 （Q6Y7Q6） ORF62 × 12 （Q6Y7Q5） ORF63 × 6 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q0_BPPGK
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain d； PDBConstruct 1–124； UniProt 1–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9tic
Deposition date deposition_date	2025-12-05
Structure title title	Phage 812 baseplate in the pre-contraction state (C3)
Keywords keywords	phage, baseplate, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9tic__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9tic__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9tic__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	182.80 Å
Total Rg	182.70 Å
Atom count	770802
Residues	97629
Excluded volume	13675000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9tic__assembly_1__model_1`	228-meric （228）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	ORF68
Molecular weight formula_weight	50474.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,8,9,w,x,y
Atom count atom_count	256934

MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYIGARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNILDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSIRDDGSASFPLLVYTSDSKTFQQAIIDHIDRTGQTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGRNVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTKNLSDDISNYSYVEVYTTHKTTEKTKGNDNTGTICHKFYLDGSGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP

Entity 2 Entity 2 polymer

Description description	ORF64
Molecular weight formula_weight	19259.6 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,P,Q,R,S,T,U,V,W,X,Y,Z,e,f,g,h,i,j,k,l,m,n,o,p

MAIATYNSHVELAKYLVSKADSVYLTIGKSTPWSNETNPPQPDENATVLQEVIGYKKATKVTLVRPSKSPEDDNKNLISYGNKSWVEVTPENAKAEGAKWVYLESSIVGDELPLGTYRQVGFVMDLVAKSGISKFNLVPSEVESTGTLLFFDNKQFQNRSEQTTAKERFIVEV

Entity 3 Entity 3 polymer

Description description	ORF65
Molecular weight formula_weight	129263.0 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3,4,5,6,7,q,r,s,t,u,v

MAINFKGSPYLDRFDPSKDRTKVLFNPDRPLQQAELNEMQSIDQYYLKNLGDAIFKDGDKQSGLGFTLSEDNVLTVNPGYVYINGKIRYYDNDDSVKITGVGKETIGIKLTERIVTPDEDASLLDQTSGVPSYFSKGADRLEEKMSLTVNDPTSATIYTFMDGDLYIQSTNAEMDKINKVLAERTYDESGSYKVNGFELFSEGNAEDDDHVSVVVDAGKAYVKGFKVDKPVSTRISVPKSYDLGTAENESTIFNKSNNSISLANSPVKEIRRVTGQVLIEKERVTRGAQGDGQDFLSNNTAFEIVKVWTETSPGVTTKEYKQGEDFRLTDGQTIDWSPQGQEPSGGTSYYVSYKYNKRMEAGKDYEVTTQGEGLSKKWYINFTPSNGAKPIDQTVVLVDYTYYLARKDSVFINKYGDIAILPGEPNIMRLVTPPLNTDPENLQLGTVTVLPDSDEAVCISFAITRLSMEDLQKVKTRVDNLEYNQAVNALDDGAMEGQNPLTLRSVFSEGFISLDKADITHPDFGIVFSFEDAEATLAYTEAVNQPKIIPGDTTAHIWGRLISAPFTEERTIYQGQASETLNVNPYNIPNKQGVLKLTPSEDNWIDTENVTITEQKTKKVTMKRFWRHNESYYGETEHYLYSNLQLDAGQKWKGETYAYDREHGRTGTLLESGGQRTLEEMIEFIRIRDVSFEVKGLNPNDNNLYLLFDGVRCAITPATGYRKGSEDGTIMTDAKGTAKGKFTIPAGIRCGNREVTLKNANSTSATTYTAQGRKKTAQDIIIRTRVTVNLVDPLAQSFQYDENRTISSLGLYFASKGDKQSNVVIQIRGMGDQGYPNKTIYAETVMNADDIKVSNNASAETRVYFDDPMMAEGGKEYAIVIITENSDYTMWVGTRTKPKIDKPNEVISGNPYLQGVLFSSSNASTWTPHQNSDLKFGIYTSKFNETATIEFEPIKDVSADRIVLMSTYLTPERTGCTWEMKLILDDMASSTTFDQLKWEPIGNYQDLDVLGLARQVKLRATFESNRYISPLMSSSDLTFTTFLTELTGSYVGRAIDMTEAPYNTVRFSYEAFLPKGTKVVPKYSADDGKTWKTFTKSPTTTRANNEFTRYVIDEKVKSSGTNTKLQVRLDLSTENSFLRPRVRRLMVTTRDE

Entity 4 Entity 4 polymer

Description description	ORF58
Molecular weight formula_weight	96199.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVVRFQSSMGRSLKRVDSDDLNVKGLVLATVSKINYKYQSVEVKVNNLTLGSRIGDDGSLAVPYPKSFIGRTPEGSVFGTKPLITEGSVVLIGFLNDDINSPIILSVYGDNEQNKMINTNPLDGGKFDTESVYKYSSSLYEILPSLNYKYDDGEGTSIRTYNGKSFFSMTSGEEEKPQATDFYTGTEYQDLFTSYYGNKTLIEPRIQKAPNMLFKHQGVFYDDGTPDNHITTLFISERGDIRASVLNTETQKRTTQEMSSDGSYRVIKQDDDLMLDEAQVWIEYGISEDNKFYIKNDKHKFEFTDEGIYIDDKPMLENLDESIAEAMKNLNEIQKELDDINYLLKGVGKDNLEELIESTKESIEASKKATSDVNRLTTQIAEVSGRTEGIITQFQKFRDETFKDFYEDASTVINEVNQNFPTMKTDVKTLKTKVDNLEKTEIPNIKTRLTELENNNNNADKIISDRGEHIGAMIQLEENVTVPMRKYMPIPWSKVTYNNAEFWDSNNPTRLVVPKGITKVRVAGNVLWDSNATGQRMLRILKNGTYSIGLPYTRDVAISTAPQNGTSGVIPVKEGDYFEFEAFQDSEGDRQFRADPYTWFSIEAIELETETMEKDFMLIGHRGATGYTDEHTIKGYQMALDKGADYIELDLQLTKDNKLLCMHDSTIDRTTTGTGKVGDMTLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDANMDRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESEMDDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEEMQSLIQMGVDGFFTNYLDEYKKI

Entity 5 Entity 5 polymer

Description description	CBM-cenC domain-containing protein
Molecular weight formula_weight	72654.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,a,b,c,z

MAFNYTPLTETQKLKDMYPKVNDIGNFLKTEVNLSDVKQISQPDFNNILASIPDSGNYYVTNSKGAPSGEATAGFVRLDKRNVNYYKIYYSPYSSNKMYIKTYANGTVYDWISFKLDEGSLYNEGNTLNVKELTESTTQYATLVNPPKENLNTGWVNYKESKNGVSSLVEFNPVNSTSTFKMIRKLPVQEQKPNLLKDSLFVYPETSYSNIKTDNWDTPPFWGYSSNSGRSGVRFRGENTVQIDDGSDTYPSVVSNRFKMGKELSVGDTVTVSVYAKINDPALLKDNLVYFELAGYDTVDDTSKNPYTGGRREITASEITTEWKKYSFTFTIPENTIGASGVKVNYVSLLLRMNCSSSKGNGAVVYYALPKLEKSSKVTPFITHENDVRKYDEIWSNWQEVISKDELKGHSPVDIEYNDYFKYQWWKSEVNEKSLKDLAMTVPQGYHTFYCQGSIAGTPKGRSIRGTIQVDYDKCDPYRANKFVKLLFTDTEGIPYTLYYGGYNQGWKPLKQSETSTLLWKGTLDFGSTEAVNLNDSLDNYDLIEVTYWTRSAGHFSTKRLDIKNTSNLLYIRDFNISNDSTGSSVDFFEGYCTFPTRTSVQPGMVKSITLDGSTNTTKVASWNEKERIKVYNIMGINRG

Entity 6 Entity 6 polymer

Description description	ORF50
Molecular weight formula_weight	15943.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,AD,AE,AF,AG,AH

MASEAKQTVHTGNTVLLMIKGKPVGRAQSASGQREYGTTGVYEIGSIMPQEHVYLRYEGTITVERLRMKKENFADLGYASLGEEILKKDIIDILVVDNLTKQVIISYHGCSANNYNETWQTNEIVTEEIEFSYLTASDKART

Entity 7 Entity 7 polymer

Description description	ORF49
Molecular weight formula_weight	64559.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,AJ,AK,AL,AM,AN

MAVEPFPRRPITRPHASIEVDTSGIGGSAGSSEKVFCLIGQAEGGEPNTVYELRNYSQAKRLFRSGELLDAIELAWGSNPNYTAGRILAMRIEDAKPASAEIGGLKITSKIYGNVANNIQVGLEKNTLSDSLRLRVIFQDDRFNEVYDNIGNIFTIKYKGEEANATFSVEHDEETQKASRLVLKVGDQEVKSYDLTGGAYDYTNAIITDINQLPDFEAKLSPFGDKNLESSKLDKIENANIKDKAVYVKAVFGDLEKQTAYNGIVSFEQLNAEGEVPSNVEVEAGEESATVTATSPIKTIEPFELTKLKGGTNGEPPATWADKLDKFAHEGGYYIVPLSSKQSVHAEVASFVKERSDAGEPMRAIVGGGFNESKEQLFGRQASLSNPRVSLVANSGTFVMDDGRKNHVPAYMVAVALGGLASGLEIGESITFKPLRVSSLDQIYESIDLDELNENGIISIEFVRNRTNTFFRIVDDVTTFNDKSDPVKAEMAVGEANDFLVSELKVQLEDQFIGTRTINTSASIIKDFIQSYLGRKKRDNEIQDFPAEDVQVIVEGNEARISMTVYPIRSFKKISVSLVYKQQTLQA

Entity 8 Entity 8 polymer

Description description	ORF57
Molecular weight formula_weight	34645.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATDKEAKDVIDKFIDNVFNFDVLTKERIKEKDEEIKKITTDDMYEKVVYIRPYVGVIQSLNPQHVQYESFSNNGYDIEAELSFRKVSYLVDKGSIPTDSLSTLTVHLVERNQELLIDYFDEIQDVLYGEYMEEEYVFDEDVPLSTILALDLNDNLKSLSNIKYMFKGAPKENPFGTDKDVYIDTYNLLYWLYLGEDEELAYPMNINYFFTEGRFFTIFGKGHKYKVDVSKFIVGDILFFGRSDTNIGIYVGDGEFISMMGKFPKDETPIGKYKLDDYWNEFNGRVMRFDEEVYI

Entity 9 Entity 9 polymer

Description description	ORF56
Molecular weight formula_weight	91364.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MRRIRRPKVRIEIVTDDNTFTLRFEDTRDYNGDEFGAKLLGFQTKNSMEDDSSVFQINMAGDTYWDKLVMANDIIRIFITPNDDPNDKEGKQERLIQVGMVSQVSKVGSYGNDQTQFRITGQSFVKPFMKFGLGVIQEVQAVLPEVGWLIDGDGDNEVKFTGSSAHEVMTGIIRRFIPYMKYNYTEKTYNTIDNYLDYDDLSSWDEFEKLTEVSAFTNFDGSLKQLMDMVTARPFNELFFKNSEKTPGKAQLVLRKTPFNPTEWRALDMIKVPTEDFIEEDVGKSDVETYSIFTATPAGMLKELNGDVFSKPQFHPELTDRYGYTKFEVENIYLSTKSGSATEDSDSSGDDNGTERGTYSKIMKDLSNYGRDNISKGIDKYTSKLSSKYKNLKKAQAKKIIEKFVKEGKVTEKEYEKITGNKVDDELTSDNRPKLTKDKLKSILKEKFKTQDDFNNSKKKKKAKTDALKELTTKYRFGNKTHATTLLDEYIKYKGEPPNDEAFDKYLKAIEGVSNVATDTGSDASDSPLVMFSRMLFNWYHGNPNFYAGDIIVLGDPKYDLGKRLFIEDKQRGDTWEFYIESVEHKFDYKQGYYTTVGVTRGLKDAILEDGKGSPHRFAGLWNQSSDFMGGLMGEDTSKELKEKGVAEKQSSGDKDGGSDSGGAQDGGSLDSLKKYNGKLPKHDPSFVQPGNRHYKYQCTWYAYNRRGQLGIPVPLWGDAADWIGGAKGAGYGVGRTPKQGACVIWQRGVQGGSPQYGHVAFVEKVLDGGKKIFISEHNYATPNGYGTRTIDMSSAIGKNAQFIYDKK

Entity 10 Entity 10 polymer

Description description	ORF60
Molecular weight formula_weight	19998.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MNNFIPQPQGLLRFLNTLDTDLTSSHMNLLDEEVSFVSKFYTPQLQLSELAKKVLTNIKTDDIPVLEREFNDNTIIHKANDTLLKVQAPRMYMILQSIVLEAYAIVNCFVENPSSLKYLTEEDVSITRENLNYVADYLGNYDDYNSVVLDLRDLDLCFSAIELQLPLIKKEANV

Entity 11 Entity 11 polymer

Description description	ORF59
Molecular weight formula_weight	29381.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

MPQSDGISNLHRIALRFPKEGGGYDMYRFKVNPENYTIDSPQRTTAIKTKSDIVIEDYGKDIEVINFTGTTGFRPVREADGLKTGKQKMEELQSRVSEYAMQGGSGNVSGSYLQFFNFTDDSYYKVHLAPQGLKITRSKDEPLLFRYEITLVVIGSLTEADRSAVTTEEFGNVKPNASQRVDEGIKELDKNARKTRDRNNQEISRRENTIPKSTGDNTNEGNRLKQSFPSSSIYNPRQSTNGLKGNIDNMALIIGYGDGGVSS

Entity 12 Entity 12 polymer

Description description	ORF61
Molecular weight formula_weight	26611.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I

MRFKKHVVQHEETMQAIAQRYYGDVSYWIDLVEHNNLKYPYLVETDEEKMKDPERLASTGDTLIIPIESDLTDVSAKEINSRDKDVLVELALGRDLNITADEKYFNEHGTSDNILAFSTNGNGDLDTVKGIDNMKQQLQARLLTPRGSLMLHPNYGSDLHNLFGLNIPEQATLIEMEVLRTLTSDNRVKSANLIDWKIQGNVYSGQFSVEIKSVEESINFVLGQDEEGIFALFE

Entity 13 Entity 13 polymer

Description description	ORF62
Molecular weight formula_weight	39248.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L,M

MKTRKLTNILSKLIDKTMAGTSKITDFTPGSASRSLLEAVSLEIEQFYILTKENIDWGIQEGIIEAFDFQKRQSKRAYGDVTIQFYQPLDMRMYIPAGTTFTSTRQEYPQQFETLVDYYAEPDSTEIVVEVYCKETGVAGNVPEGTINTIASGSSLIRSVNNEYSFNTGTKEESQEDFKRRFHSFVESRGRATNKSVRYGALQIPDVEGVYVYEETGHITVFAHDRNGNLSDTLKEDIIDALQDYRPSGIMLDVTGVEKEEVNVSATVTISNKSRIGDTLQKHIESVIRSYLNNLKTSDDLIITDLIQAIMNIDDVLIYDVSFDNLDENIIVPPQGIIRAGEIKVELK

Entity 14 Entity 14 polymer

Description description	ORF63
Molecular weight formula_weight	116389.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,O

MANFLKNLHPLLRRDRNKKDNQDPNFALIDALNEEMNQVEKDAIESKLQSSLKTSTSEYLDKFGDWFGVYRKTDEKDDVYRARIIKYLLLKRGTNNAIIDAIKDYLGRDDIDVSVYEPFTNIFYTNKSHLNGEDHLMGYYYRFAVINVSIGDYFPVEIIDVINEFKPAGVTLYVTYDGASTIRGGAIIKWLDGLPKIETYQEFDRFTGYDDTFYGHINMNQSKDTDNSSSDIFKTNHSLINSLDVLTGSSSVGRQYINYGYVTSYVYNPGMTSSVNQISASTEGRGQEVPTDYYMYTSTKNNNTVELSMQTTSGVSYLYNNFNFRDYMSKYRPQVDLQSDEARRIVSDYIKELSIDYYLSAVIPPDESIEIKLQVYDFSINRWLTVSINNLSFYEKNIGSNIGYIKDYLNSELNMFTRLEINAGKRDSVDIKVNYLDLMFYYYERGIYTIKPYKALIENYLDISRETYVEAFKIASLSNGDIITKTGFQPIGYLKLVGNYENTIPSTINIVAKDTDNNPIESNELDVYNTVENRNLLQSYKGVNTIAREITSTKEFTVSGWAKEIYSTNYLSKVLKPGKVYTLSFDMEITGNDPTLKSYSDNHGIYLYSNTKGIVVNGVKSMERTIGNKVSVTQTFTAPTITDHRLLIYTGRYTSDGKASTPPVFFNTVKITELKLTEGSSKLEYSPAPEDKPNVIEKGIKFNNILTNIQTLSINSDTILKNVTLYYSYYGDSWVELKTLGNISTGETTETNNLIDLYGLQTVDYSNINPMSKVSLRSIWNVKLGELNNQEGSLSNMPNDYFNAVWQDIDKLSDIELGSMRMVKDTEGGVFDGATGEIIKATLFNVGAYTDLDMLAYTLTNYTEPLTLGSSRLISELKEELLTSESFNVDNRIKVIDSIYEELPNTSIIKNGFVEREVTGSKYLDYGLYEPIEDGTRYKLIVEGEFKDNIEFISLYNSNPNFNETFIYPSEIINGVAEKEFIAKPSTEDKPRLNTDVRIYIRPYDSTISKVRRVELRKV

Entity 15 Entity 15 polymer

Description description	ORF67
Molecular weight formula_weight	14627.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAVKYDIGNNEIVLHLREGKYITGFTTVGGYDKELGQVKVNREILPAYFFDNFAYERYLYYSKPEEVIENKNYVPPQINDDDEESQQITVPKEQYDSLKEELELMRKQQEAMMEMLQKLLGQKG

▶

Resolution resolution	5.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	3586

Phage 812 baseplate in the pre-contraction state (C3)

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF68

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF64

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF65

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF58

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CBM-cenC domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF50

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF49

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF57

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF56

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF60

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer