← Back to search

9tp5

Crystal structure of the N-terminal Kelch domain of the Kelch phosphatase BSU1 from Arabidopsis thaliana

Method: X-RAY DIFFRACTION D_max: 59.2 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tp5
deposition_date	2025-12-17
last_revision	2026-06-03
title	Crystal structure of the N-terminal Kelch domain of the Kelch phosphatase BSU1 from Arabidopsis thaliana
keywords	protein phosphatase, ser/thr phosphatase, cell signaling, CELL CYCLE; CELL CYCLE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.74 Å
rg_electron	18.54 Å
i0	23448800.00
molecular_weight	35878.0 kDa
excluded_volume	44372 Å³
envelope_volume	51211 Å³
shell_volume	22170 Å³
envelope_diameter	60.4 Å
shell_rg	25.81 Å
envelope_rg	18.80 Å
shape_rg	18.55 Å
total_rg	19.46 Å
total_atoms	4938
n_residues	328
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	59.2 Å
rg_real	19.56 Å
rg_real_error	0.22 Å
i0_real	2.3450e+07
i0_real_error	2.5790e+05
rg_reciprocal	19.59 Å
i0_reciprocal	23450000.0000
total_estimate	0.9039
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	1
r_peak_primary	57.5 Å
skewness	0.070
kurtosis	-0.502
angular_range	— – 0.4050 Å⁻¹
current_alpha	0.0000
highest_alpha	7411000.0000
n_real_points	72
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.924; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.978; Smooth: 0.997

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Serine/threonine-protein phosphatase BSU1
formula_weight	38914.0 kDa
ec_number	3.1.3.16
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	4981

GAMAPDQSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSHQLILFGGSTTAVANHNSSLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPRACHAAALYGTLILIQGGIGPSGPSDGDVYMLDMTNNKWIKFLVGGETPSPRYGHVMDIAAQRWLVIFSGNNGNEILDDTWALDTRGPFSWDRLNPSGNQPSGRMYASGSSREDGIFLLCGGIDHSGVTLGDTYGLKMDSDNVWTPVPAVAPSPRYQHTAVFGGSKLHVIGGILNRARLIDGEAVVAVLDTETGEWVDTNQPETSASGANRQNQYQLMRRCHHAAASFGSHLYVHGGIREDVLLDDLLVAETSQSSSPE

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Spodoptera frugiperda

Entity 2 non-polymer

description	ACETATE ION
formula_weight	59.0 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	2

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	43

▶

6. Citations (2)

▶

length_a	77.313 Å
length_b	77.313 Å
length_c	134.324 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 43 21 2
int_tables_number	96
crystal_system	tetragonal

resolution	2.250 Å
resolution_low	42.400 Å
r_factor	0.2227
r_work	0.2215
r_free	0.2459

fit	/app/data/saxs_computation/tp/9tp5/9tp5.fit
pddf	/app/data/pr_computation/tp/9tp5/9tp5.pr.out
profile	/app/data/saxs_computation/tp/9tp5/9tp5.dat

Crystal structure of the N-terminal Kelch domain of the Kelch phosphatase BSU1 from Arabidopsis thaliana

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction