SAXSdb — 9u74

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

Respiratory syncytial virus A2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	PR306007 Light chain protein × 1 PR306007 Hight chain protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FUS_HRSVA
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–78； UniProt 26–103 Author chain C； PDBConstruct 1–78； UniProt 26–103 Author chain E； PDBConstruct 1–78； UniProt 26–103 Author chain B； PDBConstruct 1–377； UniProt 137–513 Author chain D； PDBConstruct 1–377； UniProt 137–513 Author chain F； PDBConstruct 1–377； UniProt 137–513

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9u74
Deposition date deposition_date	2025-03-24
Structure title title	Respiratory Syncytial Virus pre-F trimer bound by neutralizing antibody PR306007
Keywords keywords	RSV, pre-F, neutralizing antibody, IMMUNE SYSTEM (includes antibodies, antigens), STRUCTURAL PROTEIN-IMMUNE SYSTEM complex; STRUCTURAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9u74__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9u74__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9u74__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.87 Å
Rg (electron density)	39.78 Å
Total Rg	39.86 Å
Atom count	12129
Residues	1677
Excluded volume	216170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9u74__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F2
Molecular weight formula_weight	8758.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	12132

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPAT

Source Source

Source organism organism	Respiratory syncytial virus A2
NCBI taxonomy ID ncbi_taxonomy_id	1972429
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Fusion glycoprotein F1
Molecular weight formula_weight	45028.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

FLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFL

Source Source

Source organism organism	Respiratory syncytial virus A2
NCBI taxonomy ID ncbi_taxonomy_id	1972429
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	PR306007 Light chain protein
Molecular weight formula_weight	11448.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

IQLTQSPSTLSASVNDRVTLTCRASQSISSWLAWYQQKPGKAPKLLIYQASSLQSGVPSRFTGSGSGTEFTLTISSLQPDDFATYYCQQFNSYWTFGQGTKVEI

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	PR306007 Hight chain protein
Molecular weight formula_weight	13044.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

VQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRQTSRSTAYMELSSLRSEDTAVYYCAREDWGSAAFDSWGQGTMVTVSSA

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.080 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.08 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	27206

Respiratory Syncytial Virus pre-F trimer bound by neutralizing antibody PR306007

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u74__assembly_1__model_1

9u74__assembly_1__model_1 | I(q)

9u74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Respiratory Syncytial Virus pre-F trimer bound by neutralizing antibody PR306007

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u74__assembly_1__model_1

9u74__assembly_1__model_1 | I(q)

9u74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)