9uaj

Ovorubin from the golden apple snail (Pomacea canaliculata)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PcOvo5

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 其他Polymer 10	Perivitellin ovorubin-1 × 2 （J7I2T6） Perivitellin protein × 2 （A0A2T7NVP6） Perivitellin ovorubin-2 × 2 （J7HZ90） alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose × 4 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 (Z)-docos-13-enoic acid × 4 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2T7NVP5_POMCA
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–204； UniProt 399–602 Author chain F； PDBConstruct 1–204； UniProt 399–602 Author chain B； PDBConstruct 1–199； UniProt 1–199 Author chain J； PDBConstruct 1–199； UniProt 1–199

Perivitellin ovorubin-1

OrganismNot specified

UniProt J7I2T6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 其他Polymer 10	PcOvo5 × 2 （A0A2T7NVP5） PcOvo3s × 2 （A0A2T7NVP5） Perivitellin protein × 2 （A0A2T7NVP6） Perivitellin ovorubin-2 × 2 （J7HZ90） alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose × 4 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 (Z)-docos-13-enoic acid × 4 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7I2T6_POMCA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–200； UniProt 1–200 Author chain I； PDBConstruct 1–200； UniProt 1–200

Perivitellin protein

OrganismNot specified

UniProt A0A2T7NVP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 其他Polymer 10	PcOvo5 × 2 （A0A2T7NVP5） PcOvo3s × 2 （A0A2T7NVP5） Perivitellin ovorubin-1 × 2 （J7I2T6） Perivitellin ovorubin-2 × 2 （J7HZ90） alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose × 4 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 (Z)-docos-13-enoic acid × 4 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2T7NVP6_POMCA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–203； UniProt 1–203 Author chain H； PDBConstruct 1–203； UniProt 1–203

Perivitellin ovorubin-2

OrganismNot specified

UniProt J7HZ90

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 其他Polymer 10	PcOvo5 × 2 （A0A2T7NVP5） PcOvo3s × 2 （A0A2T7NVP5） Perivitellin ovorubin-1 × 2 （J7I2T6） Perivitellin protein × 2 （A0A2T7NVP6） alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose × 4 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 (Z)-docos-13-enoic acid × 4 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7HZ90_POMCA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210 Author chain G； PDBConstruct 1–210； UniProt 1–210

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uaj
Deposition date deposition_date	2025-04-01
Structure title title	Ovorubin from the golden apple snail (Pomacea canaliculata)
Keywords keywords	ovorubin, golden apple snail, Pomacea canaliculata, LIPID BINDING PROTEIN; LIPID BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uaj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uaj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uaj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.54 Å
Rg (electron density)	36.53 Å
Total Rg	37.21 Å
Atom count	14889
Residues	1817
Excluded volume	267070 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uaj__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	PcOvo5
Molecular weight formula_weight	22841.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F
Atom count atom_count	15208

MLVATLTLVALSAVFTNVYGSDQYTILDVYKASNVSVEDYKDLLKDLDVVHSFKVLGSSRVIFVVKMREDSYEKLSKINLPGDVYSIPAGDLSDKMQSVGVEWKRWDDLPDANLTLFERTLELKGEPLEGLASHMKAFGEKVSHVMELYPNKGFYLLGRTPPKAFVIVSLPFRCRQVRYGSDFALNYLNGPGDSSTKVEFVAKA

Entity 2 Entity 2 polymer

Description description	PcOvo3s
Molecular weight formula_weight	22252.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,J

MYALAIALLAFSTFVSNAFANKEYLLLDIRDATTSEIISALRDVEIELKVKAKGIARHLIVVKQNDANLQKLGEIDIPGRSCSTPVEDLDNLMEDIGISWPRNELTNVNVTLFERTLDLKDKTMEQFWSEAKAYGQLVKPVLSSFTYRAFKANGAYPPKVYFFVNLPRENLNDASSKGIDIFGGPGKARTTVQYVTKLS

Entity 3 Entity 3 polymer

Description description	Perivitellin ovorubin-1
Molecular weight formula_weight	22408.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,I

MFVATSLLLAIATLVVRASPHNYLIMDIEPPKSVSERDILNLLSPLQVKHSFRVTGSTRLLIVIRLDAQSYEKLDEITVPGKVEVIPAVNMADTMERCGVSWPRVELTDDNVTLFESESTLTDVTKEQLKAMLIGYGEHMSGLLQAHRFEYYQAAGATPHRHFVFVNSVPDEIEVFGREGVDIWGGPGEFVVKPQYVTRI

Entity 4 Entity 4 polymer

Description description	Perivitellin protein
Molecular weight formula_weight	22467.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MTAILALLLAMSILLPSGAVEDVQDLVFAEWDKGSSHEHACSALRNSSVIEKGLTVKEVGTSKFAAVLSEPILARLKFHGLVEAVPVVEVGTVMKRLNVSIPPAQDISDNNLTLIKMSPKLKGQTLQQIDAELRYLGEYMNTVLQKCSHRVYISKGTFPPKIYVFLNMPLDQIRQFYPSLDIFGGPSSTKNEISYVQILILRN

Entity 5 Entity 5 polymer

Description description	Perivitellin ovorubin-2
Molecular weight formula_weight	23827.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G

MAEHRIPVLLLLVVVAASSLAQQIPLQKHYIIYEVRNIEKTPEEVKEEMKDTDILYSFKALGAPSYHIVVEVNPRNMRKLEEVELKGKIRMVPVVNMVDVAETLGVSWPRSGARLLDVNLTLIERTLNQEGLTSQESEAHLKGFMEELKDRLQQYNYQAFFTIGASPPKMYIYINIPYEEVDKFACIGINQFGGPAAVNTTVSFISSFPK

Entity 6 Entity 6 branched

Description description	alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	570.5 kDa
Source method src_method	man
Copy count entity_count	4

Entity 7 Entity 7 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	6

Entity 8 Entity 8 non-polymer

Description description	(Z)-docos-13-enoic acid
Molecular weight formula_weight	338.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 9 Entity 9 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	319

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.12 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	336633

Ovorubin from the golden apple snail (Pomacea canaliculata)

1. Protein Identity and Related Structures Protein Identity & Related Structures

PcOvo5

State in the Current Structure

Other States of the Same Protein in the Database

Perivitellin ovorubin-1

State in the Current Structure

Other States of the Same Protein in the Database

Perivitellin protein

State in the Current Structure

Other States of the Same Protein in the Database

Perivitellin ovorubin-2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9uaj__assembly_1__model_1

9uaj__assembly_1__model_1 | I(q)

9uaj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 branched

Entity 7 Entity 7 branched

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 water

7. Citations (1)

Ovorubin from the golden apple snail (Pomacea canaliculata)

1. Protein Identity and Related Structures Protein Identity & Related Structures

PcOvo5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Perivitellin ovorubin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Perivitellin protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Perivitellin ovorubin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9uaj__assembly_1__model_1

9uaj__assembly_1__model_1 | I(q)

9uaj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 branched

Entity 7 Entity 7 branched

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 water

7. Citations (1)