SAXSdb — 9ue8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein OPG161

Monkeypox virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	345 Heavy Chain × 6 345 Light Chain × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG161_MONPV
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–124； UniProt 58–181 Author chain D； PDBConstruct 1–124； UniProt 58–181 Author chain G； PDBConstruct 1–124； UniProt 58–181 Author chain H； PDBConstruct 1–124； UniProt 58–181 Author chain K； PDBConstruct 1–124； UniProt 58–181 Author chain L； PDBConstruct 1–124； UniProt 58–181 Author chain O； PDBConstruct 1–124； UniProt 58–181 Author chain P； PDBConstruct 1–124； UniProt 58–181 Author chain S； PDBConstruct 1–124； UniProt 58–181 Author chain T； PDBConstruct 1–124； UniProt 58–181 Author chain W； PDBConstruct 1–124； UniProt 58–181 Author chain X； PDBConstruct 1–124； UniProt 58–181

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ue8
Deposition date deposition_date	2025-04-08
Last revision last_revision	2026-04-22
Structure title title	Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345
Keywords keywords	MPXV, A35R, neutralizing, antibody, VIRAL PROTEIN/IMMUNE SYSTEM, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ue8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ue8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ue8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.45 Å
Rg (electron density)	70.71 Å
Total Rg	70.67 Å
Atom count	27654
Residues	3624
Excluded volume	487130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ue8__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	345 Heavy Chain
Molecular weight formula_weight	23186.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I,M,Q,U
Atom count atom_count	27654

LVQLQESGPGLVKPSETLSLTCSVSGGSISTSSWSWIRQPPGKGLEWIGFIYNSGSANYNPSLRSRVTISVDTSKNQFSLSLSSVTAADTAVYYCARRMRASLFGSLGWLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	345 Light Chain
Molecular weight formula_weight	23445.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J,N,R,V

EIVLTQSPATLSLSPGERATLSCGASQSVSTNYIAWYQQRRGLAPRLLIYDASRRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPVTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Protein OPG161
Molecular weight formula_weight	16962.4 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,G,H,K,L,O,P,S,T,W,X

RLNQCMSANKAAITDSAVAVAAASSTHRKVVSSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGSGLNDIFEAQKIEWHEAAAHHHHHHHH

Source Source

Source organism organism	Monkeypox virus
NCBI taxonomy ID ncbi_taxonomy_id	10244
Host organism host_organism	Spodoptera frugiperda

▶

Unit-cell length a length_a	113.063 Å
Unit-cell length b length_b	126.067 Å
Unit-cell length c length_c	350.292 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	49.480 Å
R factor r_factor	0.2032
R_work r_work	0.2016
R_free r_free	0.2668

Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein OPG161

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ue8__assembly_1__model_1

9ue8__assembly_1__model_1 | I(q)

9ue8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein OPG161

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ue8__assembly_1__model_1

9ue8__assembly_1__model_1 | I(q)

9ue8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)