9unw

mouse PDCD5-TRiC complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

OrganismNot specified

UniProt P11983

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPA_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–556； UniProt 1–556

T-complex protein 1 subunit beta

OrganismNot specified

UniProt P80314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPB_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–535； UniProt 1–535

T-complex protein 1 subunit gamma

OrganismNot specified

UniProt P80318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPG_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–545； UniProt 1–545

T-complex protein 1 subunit delta

OrganismNot specified

UniProt P80315

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPD_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–539； UniProt 1–539

T-complex protein 1 subunit epsilon

OrganismNot specified

UniProt P80316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPE_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–541； UniProt 1–541

T-complex protein 1 subunit zeta

OrganismNot specified

UniProt P80317

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPZ_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–531； UniProt 1–531

T-complex protein 1 subunit eta

OrganismNot specified

UniProt P80313

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit theta × 1 （P42932） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPH_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–544； UniProt 1–544

T-complex protein 1 subunit theta

OrganismNot specified

UniProt P42932

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） Programmed cell death protein 5 × 1 （P56812）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPQ_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–548； UniProt 1–548

Programmed cell death protein 5

Mus musculus

UniProt P56812

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	T-complex protein 1 subunit alpha × 1 （P11983） T-complex protein 1 subunit beta × 1 （P80314） T-complex protein 1 subunit gamma × 1 （P80318） T-complex protein 1 subunit delta × 1 （P80315） T-complex protein 1 subunit epsilon × 1 （P80316） T-complex protein 1 subunit zeta × 1 （P80317） T-complex protein 1 subunit eta × 1 （P80313） T-complex protein 1 subunit theta × 1 （P42932）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PDCD5_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain D； PDBConstruct 35–160； UniProt 1–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9unw
Deposition date deposition_date	2025-04-24
Structure title title	mouse PDCD5-TRiC complex
Keywords keywords	Complex, cofactor, CHAPERONE; CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9unw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9unw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9unw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.91 Å
Rg (electron density)	56.53 Å
Total Rg	56.54 Å
Atom count	15218
Residues	2020
Excluded volume	273270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9unw__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	T-complex protein 1 subunit alpha
Molecular weight formula_weight	60524.5 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	15218

MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYENAVHSGALDD

Entity 2 Entity 2 polymer

Description description	T-complex protein 1 subunit beta
Molecular weight formula_weight	57556.1 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC

Entity 3 Entity 3 polymer

Description description	T-complex protein 1 subunit gamma
Molecular weight formula_weight	60710.9 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAPDAGQE

Entity 4 Entity 4 polymer

Description description	T-complex protein 1 subunit delta
Molecular weight formula_weight	58138.2 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MPENVASRSGAPTAGPGSRGKSAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVANSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVNTR

Entity 5 Entity 5 polymer

Description description	T-complex protein 1 subunit epsilon
Molecular weight formula_weight	59704.0 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MASVGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Entity 6 Entity 6 polymer

Description description	T-complex protein 1 subunit zeta
Molecular weight formula_weight	58086.2 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEQVKVSKEMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIRKKDEPIDLFMVEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVENAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKKKVCGDSDKGFVVINQKGIDPFSLDALAKEGIVALRRAKRRNMERLTLACGGIALNSFDDLNPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLVKGPNKHTLTQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAEALIKYKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKVQAEHSESGQLVGVDLSTGEPMVAAEMGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG

Entity 7 Entity 7 polymer

Description description	T-complex protein 1 subunit eta
Molecular weight formula_weight	59727.1 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMMLDELLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALVPDVLGHCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQARFH

Entity 8 Entity 8 polymer

Description description	T-complex protein 1 subunit theta
Molecular weight formula_weight	59625.3 kDa
EC 编号 ec_number	3.6.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVISGYEIACKKAHEILPELVCCSAKNLRDVDEVSSLLRTSIMSKQYGSETFLAKLIAQACVSIFPDSGNFNVDNIRVCKILGSGIYSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND

Entity 9 Entity 9 polymer

Description description	Programmed cell death protein 5
Molecular weight formula_weight	19048.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMADEELEALRKQRLAELQAKHGDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRRKVMDSDEDDADYGSGDYKDDDDK

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.55 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	659930

mouse PDCD5-TRiC complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit zeta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit eta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit theta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Programmed cell death protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9unw__assembly_1__model_1

9unw__assembly_1__model_1 | I(q)

9unw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment