← Back to search

9uo8

Crystal structure of Keap1 in complex with a small molecule inhibitor

Method: X-RAY DIFFRACTION D_max: 93.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uo8
deposition_date	2025-04-25
title	Crystal structure of Keap1 in complex with a small molecule inhibitor
keywords	PEPTIDE BINDING PROTEIN, TRANSCRIPTION; TRANSCRIPTION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	28.26 Å
rg_electron	27.90 Å
i0	133784000.00
molecular_weight	59613.0 kDa
excluded_volume	56720 Å³
envelope_volume	93583 Å³
shell_volume	28747 Å³
envelope_diameter	98.7 Å
shell_rg	34.14 Å
envelope_rg	27.91 Å
shape_rg	27.87 Å
total_rg	28.37 Å
total_atoms	4487
n_residues	570
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	93.9 Å
rg_real	28.44 Å
rg_real_error	0.63 Å
i0_real	1.3380e+08
i0_real_error	2.1370e+06
rg_reciprocal	28.39 Å
i0_reciprocal	133800000.0000
total_estimate	0.8498
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	26.8 Å
skewness	0.444
kurtosis	-0.525
angular_range	— – 0.2800 Å⁻¹
current_alpha	0.0000
highest_alpha	20120000.0000
n_real_points	57
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.758; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.858; Smooth: 0.910

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Kelch-like ECH-associated protein 1
formula_weight	31652.3 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4932

GAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVT

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Escherichia coli

Entity 2 non-polymer

description	4-ethoxy-~{N}-[4-[(4-ethoxyphenyl)sulfonylamino]-3-(2-oxidanylidene-2-pyrrol-1-yl-ethyl)naphthalen-1-yl]benzenesulfonamide
formula_weight	633.7 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	FORMIC ACID
formula_weight	46.0 kDa
src_method	syn
entity_count	7

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	445

▶

6. Citations (1)

▶

length_a	125.979 Å
length_b	75.096 Å
length_c	110.417 Å
angle_alpha	90.00 °
angle_beta	105.17 °
angle_gamma	90.00 °
z_pdb	8

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	1.800 Å
resolution_low	46.560 Å
r_factor	0.2052
r_work	0.2037
r_free	0.2342

fit	/app/data/saxs_computation/uo/9uo8/9uo8.fit
pddf	/app/data/pr_computation/uo/9uo8/9uo8.pr.out
profile	/app/data/saxs_computation/uo/9uo8/9uo8.dat

Crystal structure of Keap1 in complex with a small molecule inhibitor

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction