SAXSdb — 9ux0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cation transporter

Vibrio parahaemolyticus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	CesT family type III secretion system chaperone × 2 （Q87P37）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q87P38_VIBPA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–493； UniProt 1–492

CesT family type III secretion system chaperone

Vibrio parahaemolyticus

UniProt Q87P37

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Cation transporter × 1 （Q87P38）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q87P37_VIBPA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 6–157； UniProt 1–152 Author chain C； PDBConstruct 6–157； UniProt 1–152

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ux0
Deposition date deposition_date	2025-05-13
Structure title title	Crystal structure of the virulence effector VepA in complex with its secretion chaperone VecA
Keywords keywords	Vibrio parahaemolyticus, Type 3 secretion system, effector, TOXIN; TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ux0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ux0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ux0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.60 Å
Rg (electron density)	29.92 Å
Total Rg	30.55 Å
Atom count	5218
Residues	668
Excluded volume	92917 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ux0__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Cation transporter
Molecular weight formula_weight	53156.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5218

GMVNTTQKISQSPVPDLEQFRAIAAQKDDRVISKRGEVKEPSTFHKGHKFASVSEGVLRKKYTKFFQENIKTHLDLKQALLKEEKPETALLAYSLVSPSGYRGEPLTERKILEVVSLLDEVKVEGDTYQQLKNTFDSISKDPRMQVSLENQYPGKMDGFGAQLLEMGKEKLKGSGVNAAINLALPGVGLLVATGRELHKASVNGDAEAYHHQLEQISQLPGRDQRLSMPMQQTLAIGHAMLSAEGAVGATLGMATGGLGTFGVSSVATAGVTPIAKEAIGTALATGIISGGGFVAGQAGAYGLNNEVQDQLKQGPMSGVLPRLEISNVKGDFTFSMQEPAAVRALMAYLGPKEDTSMSSPQAPKEAQEMEAARLTLKQMLGSSPNEHLVPDVDSLLKLSDEDMPSQTESTANGAFKKLLSEDWDWLMPAVRAMDKGEANKINEKLTYKLPLDAANGRVYLDKSPNLSGAQLDALDKLGSPSQLRLMYLAEGWI

Source Source

Source organism organism	Vibrio parahaemolyticus
NCBI taxonomy ID ncbi_taxonomy_id	670
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	CesT family type III secretion system chaperone
Molecular weight formula_weight	17553.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

GPLGSMNTIQPLLDEFCRLNELPPLILEDGNRCQLLVDDRFVLYFTATEDDALMLSVAFGGLEKSGELRVRGLELLARANYQRVGSGNLALSLAPNGRQLVLAGRQPTEHLNSANLTVWFHEIIEQTELWQARFAMLDQDLSATSNHEQSHVQPLRV

Source Source

Source organism organism	Vibrio parahaemolyticus
NCBI taxonomy ID ncbi_taxonomy_id	670
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	109.848 Å
Unit-cell length b length_b	152.934 Å
Unit-cell length c length_c	101.120 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	2.490 Å
Low-resolution limit resolution_low	48.260 Å
R factor r_factor	0.2441
R_work r_work	0.2406
R_free r_free	0.2764

Crystal structure of the virulence effector VepA in complex with its secretion chaperone VecA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cation transporter

State in the Current Structure

Other States of the Same Protein in the Database

CesT family type III secretion system chaperone

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ux0__assembly_1__model_1

9ux0__assembly_1__model_1 | I(q)

9ux0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of the virulence effector VepA in complex with its secretion chaperone VecA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cation transporter

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CesT family type III secretion system chaperone

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ux0__assembly_1__model_1

9ux0__assembly_1__model_1 | I(q)

9ux0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)