9v7k

Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobiliprotein ApcE

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Glr1262 protein × 1 （Q7NL64） Allophycocyanin alpha subunit × 6 （Q7NL80） Allophycocyanin beta subunit × 6 （Q7NL79） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 1 （Q7NL78） Glr2806 protein × 1 （Q7NGT2） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL81_GLOVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–1155； UniProt 1–1155

Glr1262 protein

OrganismNot specified

UniProt Q7NL64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Phycobiliprotein ApcE × 1 （Q7NL81） Allophycocyanin alpha subunit × 6 （Q7NL80） Allophycocyanin beta subunit × 6 （Q7NL79） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 1 （Q7NL78） Glr2806 protein × 1 （Q7NGT2） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL64_GLOVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Z； PDBConstruct 1–824； UniProt 1–824

Allophycocyanin alpha subunit

OrganismNot specified

UniProt Q7NL80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Phycobiliprotein ApcE × 1 （Q7NL81） Glr1262 protein × 1 （Q7NL64） Allophycocyanin beta subunit × 6 （Q7NL79） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 1 （Q7NL78） Glr2806 protein × 1 （Q7NGT2） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL80_GLOVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–161； UniProt 1–161 Author chain C； PDBConstruct 1–161； UniProt 1–161 Author chain E； PDBConstruct 1–161； UniProt 1–161 Author chain G； PDBConstruct 1–161； UniProt 1–161 Author chain I； PDBConstruct 1–161； UniProt 1–161 Author chain K； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin beta subunit

OrganismNot specified

UniProt Q7NL79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Phycobiliprotein ApcE × 1 （Q7NL81） Glr1262 protein × 1 （Q7NL64） Allophycocyanin alpha subunit × 6 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 1 （Q7NL78） Glr2806 protein × 1 （Q7NGT2） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL79_GLOVI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–161； UniProt 1–161 Author chain D； PDBConstruct 1–161； UniProt 1–161 Author chain F； PDBConstruct 1–161； UniProt 1–161 Author chain H； PDBConstruct 1–161； UniProt 1–161 Author chain J； PDBConstruct 1–161； UniProt 1–161 Author chain L； PDBConstruct 1–161； UniProt 1–161

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q7NL78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Phycobiliprotein ApcE × 1 （Q7NL81） Glr1262 protein × 1 （Q7NL64） Allophycocyanin alpha subunit × 6 （Q7NL80） Allophycocyanin beta subunit × 6 （Q7NL79） Glr2806 protein × 1 （Q7NGT2） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL78_GLOVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–69； UniProt 1–69

Glr2806 protein

OrganismNot specified

UniProt Q7NGT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Phycobiliprotein ApcE × 1 （Q7NL81） Glr1262 protein × 1 （Q7NL64） Allophycocyanin alpha subunit × 6 （Q7NL80） Allophycocyanin beta subunit × 6 （Q7NL79） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 1 （Q7NL78） PHYCOCYANOBILIN × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NGT2_GLOVI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain X； PDBConstruct 1–729； UniProt 1–729

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9v7k
Deposition date deposition_date	2025-05-28
Structure title title	Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421
Keywords keywords	Phycobilisome, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9v7k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9v7k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9v7k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.28 Å
Rg (electron density)	39.57 Å
Total Rg	40.07 Å
Atom count	17887
Residues	2269
Excluded volume	320470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9v7k__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	130002.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	17887

MSIRGTSGSTVARPRLFRTVMTETINGINAEDRYPNSGEVSQLDQFFGDGQRRIAIVAKLTENAEMIVSRAANRIFVGGSPMAYSERQKAKAKSPLANDEFGNEPIVEDRGGFLESLKSIFSTRGGGGRASADFAVPPDFEPINIARYGPERMQKSIRDLDWFLRYTTYAILAGDPSILEANCLGLREILEKSCSISATIVALLEMRKNAARLFKDEADSKLVSSYISVVIRALDADRSDAPADIVRPSSEDRPGLTLPYIYKLSADSLTTFKMTAIYGADGRPKVNLSSDEKERVVRAAYRQVFERDLKAYGQSVSEAESKVKNGEISVREFVRRLGKSELYRREFYQPFINSRVLELAFKHFLGRAPESRAEVQKYFSIISSPIVRGQSSMPSGGLYALIDALIDSEEYTSIFGEDTVPYLRNLGVEAQPSWNWGAAYDLYNYAAPRRKVPQFITLFADYTQPLPNQHPYGAGNDPLEIQFGAIFKNSTINPAERAAPIGKDVKRILIRNGSPTSNERGNPTGMSEGATTLGPKIFKLTQNVGFRSKGMVQNAGVVTVEGSVQALITAAYQQIFGRQLYQGQRLKVAEIKLENGETTVKEFVRALGRSEIFRKLYWEPFYVCKAIEYIHRRLLGRPTYDRVENNRYFDIASKKGFYGVVDAMLNSNEYQEVFGEDVLPYERYLTPAGLSLRKGRFGSSDVLTTPGGITPRGDAARMMDKIQELGTPINERSIPEMYVNQGVPALKRQRKVFKQSQATDRESFDALVTAAYVQVFDKDIASYIRSEFSALESRLRNRETSVKEFVRLLGFSALYRKQFHDRYPNTKVVEFAFKHFLGRAVKNQAELIKYHGLLGRKGIKALIGALVDGEEYGRLYGEDTVPSWQFPTLPAANYPNSVELYNRFTRQDDSLVVPSFKPIRSKMDIASMPLVQAALKEQQATKTALDMSRPMFLELGRSFKGADGQSVEVGVGTLRRQLEHIYRIAPDATRSEKDVAINAIYRQVLDVFAGIPPSYLRLSEAESKLKNNEISVREFVRRLGRSENYRKRFFEPYSSPKVVELLTKHFLGRAPISQQEISTYVQILGTKGLAAAVDAIVESPEYLTIFNEDIVPYRRYPTLPAGNYRASVRVNDEELISQSWSSLSPTYTGYQYVTR

Entity 2 Entity 2 polymer

Description description	Glr1262 protein
Molecular weight formula_weight	92127.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSTVLDDQSKAYAPGSANGPTAGLEPFVRMSRMIRSGVPEDREEPDELWLSMVRDIFGRGYMDRLSQTRAIDYSAFVRPADQATADGAAQTKLGITAIAPDQGVELRPNFTEADVITVIRAAYKQLFGNTYILESERVIQAESLLRNGSISVREFIRILAKSDLYKERFFRCTSNNRFIELNLKHLLGRAPYNQGEIAEHLDRYCQSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQSAAAFERMRALYSGDAGSDTDRNQNGQRTELTSGLADPAQPVRARTDYALTRVDIPGGNGAAGRLAALDESLGSWLDAARDLISQNDYSQKAIEVEPKRVAPYAQYLTPAVEATPDAAAQTKLGITAVAPDQAVELRPNFGEAEVQAVIRAAYKQIFGNTYILEADRVVIAESLLRNGSISVREFVRLLAKSDLYRDRFFRTASNNRFIELNFKHFLGRAPYSQAEIGEHFNRYHKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQAARGFDQMQQLFAGDAGSDTDRGIGAQPAAKLTFPLSRPLGVTSAYFPSSQGGAATSDGLEMFTRMARELTVTPVSARRTTSPTAPTAPAMPLAGYYSRPAPRATADGDAQTKLGITAVAPAQAVELRPNFGETELQAVIRATYKQLFGNTYILEADRVVQAESLLRNGSINVREFVRLLAKSELYKERFFHCTSNNRFIELTFKHLLGRAPYNQSEFVEHLDRYQKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQTGQAAGVFERTLKLYGGDADSDTNRNRQGQLRQVDPQELLRSGRGIV

Entity 3 Entity 3 polymer

Description description	Allophycocyanin alpha subunit
Molecular weight formula_weight	17555.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K

MSVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQKRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ

Entity 4 Entity 4 polymer

Description description	Allophycocyanin beta subunit
Molecular weight formula_weight	17241.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L

MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGNMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS

Entity 5 Entity 5 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7765.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSRYFKVTACIPSLKRVRTGRELQNTFFTKLVPYENWFTEQQRIQKAGGKVLSVKLFTGVQGANTGVGA

Entity 6 Entity 6 polymer

Description description	Glr2806 protein
Molecular weight formula_weight	81544.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSATTYDWRKVIDSIKIEDPVKPGDFANFLDMARGIESRTGVWSISYESLRTLGPPEGGMLRPAVGGTAEAAAQKQLGITAVAPASVVELRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDVEIDSYIDSDEYIETFGENIVPYFRGFKYQTNQSAGGFPRMVKLWGGDAGSDTDRGKNGQRTLVTTKDLIGPTKIFVPFVAPGRDADMVSGDYTRLAFGLSGEAAAQRQLGIASVAPAPICQLRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDVEIDSYIDSDEYIETFGENIVPYFRGFKYQTNQSAGGFPRMVKLWGGDAGSDTDRATGGQRTLVTTRELVKTLPLLTEIPAVPATRGFEQVLNQLKRPAPGGTGEAQGQKQLGITAVAPAPICQLRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDAEIDSYIDSDEYLLTFGEDVVPYFRGFKYQTNQSAGGFPRFTKLYGGDAGSDTDRGKNGQRTLVTTKDLVVSGQFSKPV

Entity 7 Entity 7 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.94 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	746972

Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glr1262 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glr2806 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9v7k__assembly_1__model_1

9v7k__assembly_1__model_1 | I(q)

9v7k__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)