9v7u

PSI-LHCE supercomplex from Euglena gracilis.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt P19430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_EUGGR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P19431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_EUGGR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P31556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_EUGGR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P30394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_EUGGR
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P31479

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_EUGGR
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPE4_EUGGR
Isoform	—
PDB entities	9, 10
Chains and sequence ranges	Author chain a； PDBConstruct 1–166； UniProt 615–780 Author chain b； PDBConstruct 1–169； UniProt 73–241

Light harvesting chlorophyll a /b binding protein of PSII

OrganismNot specified

UniProt Q39725

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q39725_EUGGR
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain d； PDBConstruct 1–220； UniProt 356–575

Chloroplast light-harvesting complex II protein

OrganismNot specified

UniProt A8HPH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPH1_EUGGR
Isoform	—
PDB entities	13, 22
Chains and sequence ranges	Author chain e； PDBConstruct 1–199； UniProt 151–349 Author chain n； PDBConstruct 1–184； UniProt 362–545

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPD0_EUGGR
Isoform	—
PDB entities	16, 21, 23
Chains and sequence ranges	Author chain j； PDBConstruct 1–183； UniProt 216–398 Author chain g； PDBConstruct 1–178； UniProt 219–396 Author chain o； PDBConstruct 1–164； UniProt 36–199

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPC6_EUGGR
Isoform	—
PDB entities	17, 24
Chains and sequence ranges	Author chain k； PDBConstruct 1–172； UniProt 8–179 Author chain p； PDBConstruct 1–148； UniProt 389–536

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein, Lhca7_2 × 1 （A8HPD3） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPD7_EUGGR
Isoform	—
PDB entities	18, 19
Chains and sequence ranges	Author chain l； PDBConstruct 1–167； UniProt 64–230 Author chain m； PDBConstruct 1–168； UniProt 64–231

Chloroplast light-harvesting complex I protein, Lhca7_2

OrganismNot specified

UniProt A8HPD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） LHCE 3 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） LHCE 8 × 1 LHCE 9 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD7） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex II protein × 1 （A8HPH1） Chloroplast light-harvesting complex I protein × 1 （A8HPD0） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） CHLOROPHYLL A × 276 DODECYL-BETA-D-MALTOSIDE × 1 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 PHYLLOQUINONE × 4 BETA-CAROTENE × 13 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 41 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 CHLOROPHYLL B × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPD3_EUGGR
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain f； PDBConstruct 1–174； UniProt 164–337

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9v7u
Deposition date deposition_date	2025-05-28
Structure title title	PSI-LHCE supercomplex from Euglena gracilis.
Keywords keywords	PSI-eLHCI, Euglena gracilis., PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9v7u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9v7u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9v7u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.59 Å
Rg (electron density)	67.14 Å
Total Rg	66.90 Å
Atom count	55406
Residues	4901
Excluded volume	1025000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9v7u__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	84073.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	55406

MTITPPEQQVKRVRVAFVSNPVETSFEKWSRPGHFSRLLSKGPNTTTWIWNLHADAHDFDNHTTDLEDISRKVFSAHFGQLAIIEIWLSGMFFHGARFSNYEAWLLDPIHVKPSAQIVWPIVGQEILNGDVGGNFQGIQITSGLFQLWRSCGITSEFQLYITALTGLIFSAVLFFAGWFHYHKAAPKLEWFQNVESMLNHHLSGLLGLGCLSWAGHQIHVSLPINKLLDSGVNPAELPLPHDFILDKSLISQLYPSFSKGLAPFFTFHWSEYSDFLTFRGGLNNVTGGLWLTDVAHHHLALAVLFILAGHMYKTNWKIGHDIKGLLESHTGPFTGQGHKGLYEIFTNSWHAQLSLNLAMMGSLSIIVAQHMYSMPPYPYIAIDYGTELSLFTHHYWIGGFCIVGAAAHAAIFMVRDYDPALNFNNLLDRVLLHRDAIISHLNWVCIFLGLHSFGLYIHNDTLSALGRPQDMFSDSAIQLQPVFAQWIQNTHYLAPTLTAFNLVSPTTPVWGGDVVSISGKVAMMPIKLGTADFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKASLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVAIFHFSWKMQSDVWGTVLANKVSHITGGNFSQGSLTINGWLRDFLWAQSSQVIQSYGSPLSAYGLMFLGAHFVWAFTLMFLFSGRGYWQELIESIVWAHNKLKVAPNIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82780.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQGLAQDPTTRRIWFGIATSHDFESHDGMTENNLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNFEQWIKDPLHIRPIAHAISDPHFGQPAIEAFTRSQFPGPVNIAYSGVYQWWYTIGLRTNVDLYNGSMFLLFIATLALFAGWLHLEPKYSPKVSWFKDAESRLNHHLSALFGLSSLAWSGHLIHVAIPESRGIHVRWDNFLSQLPHPSGLEPFFKGNWSLYSENPDSLTHVFGTASGAGTAVLTFLGGFHPETKSLWLTDIAHHHLAIAVLFIVAGHMYRTNFAIGHRIDDILNAHKAPSGKLGLGHFGLYETINNSLHFQLGLALASLGVITSLVAQHMYSLSPYAFLIQDRTTMAALYTHHQYIAGFIMTGAFAHGAIFFIRDFDEEKNKGNVLSRILDHKEAIISHLSWVTLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQSAHGKNIYELNILLSSDSSNAFSASQAIWLPGWLNGINDKSTSLFLQIGPGDFLVHHAIALGLHTTTLILVKGALDARGSRLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWTTFYWHWKHITLWQGNVGQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLAVWGWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTPITNVFKWTDKPVALSIVQARLVGLAHFSVGYVFTYAAFLIASTSAKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8784.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYNTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCESACPTDFLSVRVYLGSETSRSMGLAY

Entity 4 Entity 4 polymer

Description description	PsaD
Molecular weight formula_weight	19742.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

AVVPDLAAADDDIAAVSKAIADASQLPIFWMLRDALSCVPRSQFPTVFATYKGSTGSLLASATTEEFYVITWTVPKEQIFEIPTGGAALMNEGVNIFFFARKEQCLALGAQLRSSFAPKITDFQIYRVFPDGAVQYLHPKDGVFPEKVNGGRAKANFNSRDIGDNANPVNSAFSGAAAKAAAAAAA

Entity 5 Entity 5 polymer

Description description	PsaE
Molecular weight formula_weight	6797.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

AGPALGSVVKILRPESYWYNQFGTVIAVDASGGIRYSVVVRFAKQNYEGVTVNNFALDELVAA

Entity 6 Entity 6 polymer

Description description	PsaF
Molecular weight formula_weight	17765.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

AEAILGLTPCSDSAMFQEVLVKEVKALNQRENLYDAGSAPYLALKATKAKTQARFANYAVAGLLCGADGLPHLIADPGLAVKYGHAGEVDIPTIGFLYVAGYIGVAGRVYLQTISTRDNPTEKEIIINVPLATSIAFKSWDWPDEAVQELAAGTLLESAMNVPTAKGA

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4298.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MKYFTTYLSTAPVVAVLWFTLTASLLIEINRFFPDIL

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3445.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MEITTNQVYIALLASLIPAFFAFKLGKSLNQ

Entity 9 Entity 9 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	18071.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

RATWFPGAKAPPHLTGEFPGDRGFDPVDFAANPESFERMRASEVFHGRMAMLGVAGCLIPELLGRGVWFQAGESVDAAQLGLYFMFLAAPSEYWRGNGGFGWDQKEKKAGNRIYPGFDPLKMTSDETKTKEIKNGRLAMIAFLGLVSQANTTGVSPFQNLAAVFGA

Entity 10 Entity 10 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	18403.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

WFPGATPPAYLTGEFPADRGFDPLGLAKDPATYERMRSSEVFHSRLAMLGVVGSLIPELQGQGAWYTLSEKQFGPGPNGEVIGFTELALIGMLFSYPLEYWRGNGGFGWFEEKGDRTYPGFDPLQLTSEYTKTAEIKNGRLAMSALLGFAVQHATTGASPLENWAATTG

Entity 11 Entity 11 polymer

Description description	LHCE 3
Molecular weight formula_weight	23742.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

LSDWYGPNRKLFLGPLSDGAPEHLKGELPGDYGFDVLGLATQPTRLERYRQGEIINGRWAMLGIVGCIVPELLARNYGVPFPEPVWFKTGATVFSEEGLNYLGNPSLIHAKSIAAILVTEILFVGAAEAFRVSGGPLGPATDLVYPGKAFDPLGLSKDATAFAELKVKEVKNGRLAMLGMLGLFMQGFATGKGPLQNLADHLADPTGANIITFHQRVLSDL

Entity 12 Entity 12 polymer

Description description	Light harvesting chlorophyll a /b binding protein of PSII
Molecular weight formula_weight	23581.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

GSKWYGPNRPKWLGPLSGGAVPEYLKGEYAGDYGFDTAGLAADPKLFQRYRDAELQNGRWAMLGVLGCLAPEVLSNVFGVPYPEPVWFKTGATILNGGSIDYLANPKLIHASNLLLTLVLELVFFFAAETWREAGEGPLGKAQDKSYPGGVFDPLGLSKDPAAFAEAKVKEVKNGRLAMLAMLGLFVQAGVTGQSPLENLSAHLANPGVNFWTSYAPTLA

Entity 13 Entity 13 polymer

Description description	Chloroplast light-harvesting complex II protein
Molecular weight formula_weight	21448.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

RPTWFPGAEAPTWLTGEYPGDRGFDPFGLAKDPADFAKFRDSEVFHGRWAMLGLVGCLVPEVFGNLGIAQLPAWYDAATVANTSNLDYLGNPNLVHASNVSFIALSTLLLMGPVEAWRWNGALASEAKSAERTTYPGGPFDPLKLGASPELKLKEIKNGRLAMVGMFGFWAQSYVTGEGPLANLAAHLADPAHNNLLNT

Entity 14 Entity 14 polymer

Description description	LHCE 8
Molecular weight formula_weight	19140.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

RLLWIPNATPPAHLTGEFPGDRGFDPLGLAKDPKVYQRMRISEVFHGRLAMLGIVGCVAPELFFSKGAWFDYSDYDLNRLGLIALQVIAPLEYWRGNGGFSWDGNDGPDRSYPGFDPLGLTNEETKLQEIKNGRLAMTAMLGLEVQSHITGKSPLTNLSEHLSHPLSANLLTGG

Entity 15 Entity 15 polymer

Description description	LHCE 9
Molecular weight formula_weight	19198.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

RPLWFPGGYAPSWLTGQHFGDRGFDPAGLAADPKVFERMRVSEVYHGRLAMLAIVGAVVPDIQGKGAWYEAAQSAGIGVNEVAVFTAAYGIAEVARGLKANSDPTKRYSGFDSLNLTTDYTKEAEIKNGRLALTAMLGLQVQRHVTGVSPLVNLVEHVKHPLNHNIAESVMHQWPVA

Entity 16 Entity 16 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	20493.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

EKYRGLWFPNITPPAYLTGEFPADRGFDPAGLAADPKVYERMRIAEVFNGRLAMLAIVGCVYPELLGNGVWFEVWNKVDFYRFALISLQVVAPLEYWRGNGGFGWDGEEKYDRSYPGFDPCNLTTEYTKAAEIKNGRLAMIGMFGLEVQSHVTAQGPVANLIEHLRHPLAANIGANLAHPWPP

Entity 17 Entity 17 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	18959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

RLLWIPNATPPAHLTGEFPGDRGFDPLGLSKDPKVFARMRISEVFHGRLAMLGIVGCVGQEWLFNKGAWFDYSDFDLPRLGLIALQVIAPLEYWRGNGGFSWNGNDGPDRSYPGFDPLGLTTEDTKLREIKNGRLAMSAMLGLEVQSHITGKSPLTNLGDHLSSPFTANILT

Entity 18 Entity 18 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	17778.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

HKDGVWFPGATPPAHLTGEYPADRGFDPLSLAADPTVYARMRVSEVFHARLSMLAIVGAIVPEVLGKGAWFEAGNSVDGIKLGFIAMAIAAPTEYWRGNGGFNWDKGAADRSYPGFDPLKLTTDYTKAAEIKNGRLAMAGLLGLTFQYLATGESPLANLAAHLANPV

Entity 19 Entity 19 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	17835.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

HKDGVWFPGATPPAHLTGEYPADRGFDPLSLAADPTVYARMRVSEVFHARLSMLAIVGAIVPEVLGKGAWFEAGNSVDGIKLGFIAMAIAAPTEYWRGNGGFNWDKGAADRSYPGFDPLKLTTDYTKAAEIKNGRLAMAGLLGLTFQYLATGESPLANLAAHLANPVG

Entity 20 Entity 20 polymer

Description description	Chloroplast light-harvesting complex I protein, Lhca7_2
Molecular weight formula_weight	18875.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

RPLWFPGGYAPSWLTGQHFGDRGFDPAGLAADPKVFERMRVSEVYHGRLAMLAIVGAVVPDIQGKGAWYEAAQSAGIGVNEVAVFTAAYGIAEVARGLKANSDPTSRYSGFDSLNLTTDYTKEAEIKNGRLALTAMLGLQVQRHVTGVSPLLNLVEHVKHPLVHTIAESVMHQW

Entity 21 Entity 21 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	19877.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

RGLWFPNITPPAYLTGEFPADRGFDPAGLAADPKVYERMRIAEVFNGRLAMLAIVGCVYPELLGNGVWFEVWNKVDFYRFALISLQVVAPLEYWRGNGGFGWDGEEKYDRSYPGFDPCNLTTEYTKAAEIKNGRLAMIGMFGLEVQSHVTAQGPVANLIEHLRHPLAANIGANLAHPW

Entity 22 Entity 22 polymer

Description description	Chloroplast light-harvesting complex II protein
Molecular weight formula_weight	19923.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

TWFPGAEAPAWLTGEYPGDRGFDPLGLAKDPEDFAKNRDSEVYHGRWAMLGLVGCLVPEVFGNLGIAQLPAWYEAGAVANTGSLDYLGNPNLVHASNVPLIFFTTLLLFLPIEAWRWNGQIAPEAKSAERTTYPGGPFDPLKLGASPELKLKEIKNGRLAMVGMFGFWAQSYVTGEGPLANLAA

Entity 23 Entity 23 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	17411.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

DGVWFPGATPPAHLTGEYPADRGFDPLSLAADPTVYARMRVSEVFHARLSMLAIVGAIVPEVLGKGAWFEAGNSVDGIKLGFIAMAIAAPTEYWRGNGGFNWDKGAADRSYPGFDPLKLTTDYTKAAEIKNGRLAMAGLLGLTFQYLATGESPLANLAAHLANP

Entity 24 Entity 24 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	15965.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

PPAHLTGEYPADRGFDPLSLAADPTVYARMRVSEVFHARLSMLAIVGSIVPELLGKGAWFEVGNSVDGIKLGFILMAIAAPTEYWRGNGGFNWDKGTADRSYPGFDPLKLTTDYTKAAEIKNGRLAMTGLLGLTFQYLATGESPLANL

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	276

Entity 26 Entity 26 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 28 Entity 28 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 29 Entity 29 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 30 Entity 30 non-polymer

Description description	(3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol
Molecular weight formula_weight	582.9 kDa
Source method src_method	syn
Copy count entity_count	41

Entity 31 Entity 31 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 32 Entity 32 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 33 Entity 33 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 34 Entity 34 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Resolution resolution	2.630 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.63 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	562173

PSI-LHCE supercomplex from Euglena gracilis.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting chlorophyll a /b binding protein of PSII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex II protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer