9vjs

Cryo-EM structure of Euglenophyte photosystem I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt P19430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_EUGGR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P19431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_EUGGR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 1–733

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P31556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_EUGGR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P30394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_EUGGR
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P31479

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_EUGGR
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31

Light harvesting chlorophyll a /b binding protein of PSII

OrganismNot specified

UniProt Q39725

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q39725_EUGGR
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain b； PDBConstruct 1–225； UniProt 351–575

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPE4_EUGGR
Isoform	—
PDB entities	12, 13
Chains and sequence ranges	Author chain d； PDBConstruct 1–184； UniProt 62–245 Author chain e； PDBConstruct 1–177； UniProt 608–784

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPC6_EUGGR
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain f； PDBConstruct 1–185； UniProt 1–185

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） LHC-10, 15 × 2 LHC-11 × 1 Chloroplast light-harvesting complex I protein × 4 （A8HPD7） CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPD0_EUGGR
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain g； PDBConstruct 1–191； UniProt 210–400 Author chain j； PDBConstruct 1–191； UniProt 210–400

Chloroplast light-harvesting complex I protein

OrganismNot specified

UniProt A8HPD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P19430） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P19431） Photosystem I iron-sulfur center × 1 （P31556） PsaD × 1 PsaE × 1 PsaF × 1 Photosystem I reaction center subunit IX × 1 （P30394） Photosystem I reaction center subunit XII × 1 （P31479） LHC-1 × 1 Light harvesting chlorophyll a /b binding protein of PSII × 1 （Q39725） LHC-3 × 1 Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPE4） Chloroplast light-harvesting complex I protein × 1 （A8HPC6） Chloroplast light-harvesting complex I protein × 2 （A8HPD0） LHC-10, 15 × 2 LHC-11 × 1 CHLOROPHYLL A × 244 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 37 BETA-CAROTENE × 13 DODECYL-ALPHA-D-MALTOSIDE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHLOROPHYLL B × 27 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPD7_EUGGR
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain k； PDBConstruct 1–174； UniProt 429–602 Author chain l； PDBConstruct 1–174； UniProt 429–602 Author chain m； PDBConstruct 1–174； UniProt 429–602 Author chain n； PDBConstruct 1–174； UniProt 429–602

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9vjs
Deposition date deposition_date	2025-06-21
Structure title title	Cryo-EM structure of Euglenophyte photosystem I
Keywords keywords	Euglenophyte, Photosystem I, evolution, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9vjs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9vjs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9vjs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.55 Å
Rg (electron density)	68.26 Å
Total Rg	68.00 Å
Atom count	54391
Residues	4732
Excluded volume	1008700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9vjs__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	84059.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	54391

MTITPPEQQVKRVRVAFVSNPVETSFEKWSRPGHFSRLLSKGPNTTTWIWNLHADAHDFDNHTTDLEDISRKVFSAHFGQLAIIEIWLSGMFFHGARFSNYEAWLLDPIHVKPSAQIVWPIVGQEILNGDVGGNFQGIQITSGLFQLWRSCGITSEFQLYITALTGLIFSAVLFFAGWFHYHKAAPKLEWFQNVESMLNHHLSGLLGLGCLSWAGHQIHVSLPINKLLDSGVNPAELPLPHDFILDKSLISQLYPSFSKGLAPFFTFHWSEYSDFLTFRGGLNNVTGGLWLTDVAHHHLALAVLFILAGHMYKTNWKIGHDIKGLLESHTGPFTGQGHKGLYEIFTNSWHAQLSLNLAMMGSLSIIVAQHMYSMPPYPYIAIDYGTELSLFTHHYWIGGFCIVGAAAHAAIFMVRDYDPALNFNNLLDRVLLHRDAIISHLNWVCIFLGLHSFGLYIHNDTLSALGRPQDMFSDSAIQLQPVFAQWIQNTHYLAPTLTAFNLVSPTTPVWGGDVVSISGKVAMMPIKLGTADFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKASLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVAIFHFSWKMQSDVWGTVLANKVSHITGGNFSQGSLTINGWLRDFLWAQSSQVIQSYGSPLSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPNIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82723.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQGLAQDPTTRRIWFGIATSHDFESHDGMTENNLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNFEQWIKDPLHIRPIAHAISDPHFGQPAIEAFTRSQFPGPVNIAYSGVYQWWYTIGLRTNVDLYNGSMFLLFIATLALFAGWLHLEPKYSPKVSWFKDAESRLNHHLSALFGLSSLAWSGHLIHVAIPESRGIHVRWDNFLSQLPHPSGLEPFFKGNWSLYSENPDSLTHVFGTASGAGTAVLTFLGGFHPETKSLWLTDIAHHHLAIAVLFIVAGHMYRTNFAIGHRIDDILNAHKAPSGKLGLGHFGLYETINNSLHFQLGLALASLGVITSLVAQHMYSLSPYAFLIQDRTTMAALYTHHQYIAGFIMTGAFAHGAIFFIRDFDEEKNKGNVLSRILDHKEAIISHLSWVTLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQSAHGKNIYELNILLSSDSSNAFSASQAIWLPGWLNGINDKSTSLFLQIGPGDFLVHHAIALGLHTTTLILVKGALDARGSRLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWTTFYWHWKHITLWQGNVGQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLAVWGWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTPITNVFKWTDKPVALSIVQARLVGLAHFSVGYVFTYAAFLIASTSAKF

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8784.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYNTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCESACPTDFLSVRVYLGSETSRSMGLAY

Entity 4 Entity 4 polymer

Description description	PsaD
Molecular weight formula_weight	22389.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MFAETGEKAAKPAWTVPDLADALKNTSAVAKAKGIATQLPTFWELRDALSEVPKSKFPEVFASYKGSTGTLLSAAEKEEKYVITWTSPKKQIFELPTGGAAEMEEGENIFYFARKEQCLALGAQLRTAFKPRIENFQIFRVFPNGEVQYLHPKDGVFPEKVNQGRTKANHNPRSIGENAEPASVKFTGTTPKDVQTEGAVAMF

Entity 5 Entity 5 polymer

Description description	PsaE
Molecular weight formula_weight	11251.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MITRLADDAAARVADRTQFIEEYKERRAEAPATPKAKAGPARGSTVKVTRPESYWYNQYGKVISVDESGAIRYPVVVRFEKENYQGVTTNNFALDELEY

Entity 6 Entity 6 polymer

Description description	PsaF
Molecular weight formula_weight	18556.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MPANATEAILGLTPCAESAKFQKVLTKEVKALEKREKLYEPGSAPFQALEATKAKTQARFAKYAESGLLCGADGLPHLISDPGLAVKYGHAGETLIPTIGFLYVAGYIGTAGRTYLQEISTRQKPTQSEIIIDVPLATSIAFKSWDWPNKAVKELASGTLLEDAKNVPVSRR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4298.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MKYFTTYLSTAPVVAVLWFTLTASLLIEINRFFPDIL

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3445.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MEITTNQVYIALLASLIPAFFAFKLGKSLNQ

Entity 9 Entity 9 polymer

Description description	LHC-1
Molecular weight formula_weight	22417.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MLATSGEKRPTWFPGAEAPAWLTGEFPGDRGFDPCGLARDPVDFAKFRDSEVFHGRWAMLGLVGCLVPEVFGNLGIAQLPAWYDAATVANTSNLDYLGNPNLIHASNVSFIALSTLLLMGPVEAWRWNGALASEAKSAERTTYPGGPFDPLKLGASPELKLKEIKNGRLAMVGMFGFWAQSYVTGEGPLANLAAHLADPAHNNLLNTVA

Entity 10 Entity 10 polymer

Description description	Light harvesting chlorophyll a /b binding protein of PSII
Molecular weight formula_weight	24103.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MFAATGSKWYGPNRPKWLGPLSGGAVPEYLKGEYAGDYGFDTAGLAADPKLFQRYRDAELQNGRWAMLGVLGCLAPEVLSNVFGVPYPEPVWFKTGATILNGGSIDYLANPKLIHASNLLLTLVLELVFFFAAETWREAGEGPLGKAQDKSYPGGVFDPLGLSKDPAAFAEAKVKEVKNGRLAMLAMLGLFVQAGVTGQSPLENLSAHLANPGVNFWTSYAPTLA

Entity 11 Entity 11 polymer

Description description	LHC-3
Molecular weight formula_weight	24694.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MFAATGEKLSDWYGPNRKLFLGPLSDGAPEHLKGELPGDYGFDVLGLATQPTRLERYRQGEIINGRWAMLGIVGCIVPELLARNYGVPFPEPVWFKTGATVFSEEGLNYLGNPSLIHAKSIAAILVTEILFVGAAEAFRVSGGPLGPATDLVYPGKAFDPLGLSKDETAFAELKVKEVKNGRLAMLGMLGLFMQGFATGKGPLQNLADHLADPTGANIITFHQRVLSDLG

Entity 12 Entity 12 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	19968.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MFTTTGEKRPVWFPGATPPAYLTGEFPADRGFDPLGLAKDPATYERMRSSEVFHSRLAMLGVVGSLIPELQGQGAWYTLSEKQFGPGPNGEVIGFTELALIGMLFSYPLEYWRGNGGFGWFEEKGDRTYPGFDPLQLTSEYTKTAEIKNGRLAMSALLGFAVQHATTGASPLENWAATTGGSVA

Entity 13 Entity 13 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	19103.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MFAAAGERATWFPGAKAPPHLTGEFPGDRGFDPVDFAANPESFERMRASEVFHGRMAMLGVAGCLIPELLGRGVWFQAGESVDAAQLGLYFMFLAAPSEYWRGNGGFGWDQKEKKAGNRIYPGFDPLKMTSDETKTKEIKNGRLAMIAFLGLVSQANTTGVSPFQNLAAVFGASPVA

Source Source

Source organism organism	Euglena gracilis
NCBI taxonomy ID ncbi_taxonomy_id	3039
Host organism host_organism	Euglena gracilis

Entity 14 Entity 14 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	20021.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MAASSGERLLWIPNATPPAHLTGEFPGDRGFDPLGLSKDPKVFARMRISEVFHGRLAMLGIVGCVGQEWLFNKGAWFDYSDFDLPRLGLIALQVIAPLEYWRGNGGFSWNGNDGPDRSYPGFDPLGLTTEDTKLREIKNGRLAMSAMLGLEVQSHITGKSPLTNLGDHLSSPFTANILTGGGSVA

Entity 15 Entity 15 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	21290.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,j

MYSTSGEKYRGLWFPNITPPAYLTGEFPADRGFDPAGLAADPKVYERMRIAEVFNGRLAMLAIVGCVYPELLGNGVWFEVWNKVDFYRFALISLQVVAPLEYWRGNGGFGWDGEEKYDRSYPGFDPCNLTTEYTKAAEIKNGRLAMIGMFGLEVQSHVTAQGPVANLIEHLRHPLAANIGANLAHPWPPVA

Entity 16 Entity 16 polymer

Description description	LHC-10, 15
Molecular weight formula_weight	20346.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,o

MFSTAGQKTDRRPLWFPGGYAPSWLTGQHFGDRGFDPAGLAADPKVFERMRVSEVYHGRLAMLAIVGAVVPDIQGKGAWYEAAQSAGIGVNEVAVFTAAYGIAEVARGLKANSDPTSRYPGFDPLNLTTDYTKEAEIKNGRLALTAMLGLEVQRHVTGVSPLVNLVEHVKHPLGHNIAESVMHQWPVA

Entity 17 Entity 17 polymer

Description description	LHC-11
Molecular weight formula_weight	20130.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAATTGERLLWIPNATPPAHLTGEFPGDRGFDPLGLAKDPKVYQRMRISEVFHGRLAMLGIVGCVAPELFFSKGAWFDYSDYDLNRLGLIALQVIAPLEYWRGNGGFSWDGNDGPDRSYPGFDPLGLTNEETKLQEIKNGRLAMTAMLGLEVQSHITGKSPLTNLSEHLSHPLSANLLTGGGSLA

Entity 18 Entity 18 polymer

Description description	Chloroplast light-harvesting complex I protein
Molecular weight formula_weight	18444.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l,m,n

MFATTGHKDGVWFPGATPPAHLTGEYPADRGFDPLSLAADPTVYARMRVSEVFHARLSMLAIVGAIVPEVLGKGAWFEAGNSVDGIKLGFIAMAIAAPTEYWRGNGGFNWDKGAADRSYPGFDPLKLTTDYTKAAEIKNGRLAMAGLLGLTFQYLATGESPLANLAAHLANPVG

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	244

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	(3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol
Molecular weight formula_weight	582.9 kDa
Source method src_method	syn
Copy count entity_count	37

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 24 Entity 24 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 26 Entity 26 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 27 Entity 27 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 29 Entity 29 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	2.72 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	78124

Cryo-EM structure of Euglenophyte photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting chlorophyll a /b binding protein of PSII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chloroplast light-harvesting complex I protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer