← Back to search

9v8g

PPARgamma ligand-binding domain in complex with PG08-NL

Method: X-RAY DIFFRACTION D_max: 63.0 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9v8g
deposition_date	2025-05-29
title	PPARgamma ligand-binding domain in complex with PG08-NL
keywords	Nuclear receptor, de novo peptide, TRANSCRIPTION; TRANSCRIPTION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	20.16 Å
rg_electron	18.87 Å
i0	15452800.00
molecular_weight	31116.0 kDa
excluded_volume	39726 Å³
envelope_volume	45543 Å³
shell_volume	20164 Å³
envelope_diameter	63.8 Å
shell_rg	25.24 Å
envelope_rg	19.02 Å
shape_rg	18.84 Å
total_rg	19.94 Å
total_atoms	2189
n_residues	271
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	63.0 Å
rg_real	20.06 Å
rg_real_error	0.30 Å
i0_real	1.5450e+07
i0_real_error	1.7090e+05
rg_reciprocal	20.08 Å
i0_reciprocal	15450000.0000
total_estimate	0.9006
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	25.2 Å
skewness	0.184
kurtosis	-0.418
angular_range	— – 0.3950 Å⁻¹
current_alpha	0.0000
highest_alpha	3213000.0000
n_real_points	71
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.908; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.990; Smooth: 0.989

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Peroxisome proliferator-activated receptor gamma
formula_weight	31449.5 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2441

QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 polymer

description	PG08-NL
formula_weight	2133.6 kDa
src_method	syn
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

YKTANSVXVRHXLLTAILXX

Entity 3 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	230

▶

6. Citations (1)

▶

length_a	43.820 Å
length_b	53.860 Å
length_c	66.860 Å
angle_alpha	90.00 °
angle_beta	106.04 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	monoclinic

resolution	1.390 Å
resolution_low	42.110 Å
r_factor	0.1717
r_work	0.1714
r_free	0.1823

fit	/app/data/saxs_computation/v8/9v8g/9v8g.fit
pddf	/app/data/pr_computation/v8/9v8g/9v8g.pr.out
profile	/app/data/saxs_computation/v8/9v8g/9v8g.dat

PPARgamma ligand-binding domain in complex with PG08-NL

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (4)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 non-polymer

Entity 4 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)