← Back to search

9vea

The MIDN Catch-IRF4 (A8I) fusion protein

Method: X-RAY DIFFRACTION D_max: 46.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9vea
deposition_date	2025-06-09
last_revision	2026-02-04
title	The MIDN Catch-IRF4 (A8I) fusion protein
keywords	Midnolin, IRF4, proteasome, NUCLEAR PROTEIN; NUCLEAR PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	15.09 Å
rg_electron	13.64 Å
i0	3249460.00
molecular_weight	12708.0 kDa
excluded_volume	15925 Å³
envelope_volume	17907 Å³
shell_volume	11390 Å³
envelope_diameter	44.0 Å
shell_rg	19.09 Å
envelope_rg	13.76 Å
shape_rg	13.64 Å
total_rg	14.83 Å
total_atoms	892
n_residues	119
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	46.1 Å
rg_real	14.98 Å
rg_real_error	0.29 Å
i0_real	3.2490e+06
i0_real_error	3.7550e+04
rg_reciprocal	14.99 Å
i0_reciprocal	3249000.0000
total_estimate	0.8280
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	44.3 Å
skewness	0.066
kurtosis	-0.432
angular_range	— – 0.5000 Å⁻¹
current_alpha	0.0000
highest_alpha	335800.0000
n_real_points	80
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.889; Stabil: 0.991; Sysdev: 1.000; Positv: 1.000; Valcen: 0.981; Smooth: 0.138

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	Midnolin,Interferon regulatory factor 4
formula_weight	7247.2 kDa
mutation	A222I
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	892

PEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAWPACENGCQVTGTFYICAPPE

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli (strain B / BL21-DE3)

Entity 2 polymer

description	Midnolin
formula_weight	7809.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

PGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAGSGS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli (strain B / BL21-DE3)

▶

6. Citations (1)

▶

length_a	88.255 Å
length_b	88.255 Å
length_c	69.794 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 65 2 2
int_tables_number	179
crystal_system	hexagonal

resolution	3.600 Å
resolution_low	31.740 Å
r_factor	0.2390
r_work	0.2371
r_free	0.2718

fit	/app/data/saxs_computation/ve/9vea/9vea.fit
pddf	/app/data/pr_computation/ve/9vea/9vea.pr.out
profile	/app/data/saxs_computation/ve/9vea/9vea.dat

The MIDN Catch-IRF4 (A8I) fusion protein

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)