SAXSdb — 9vfr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-meric（300） Consistent with protein copy count	Chain A； UniProt 1–305	Not recorded	Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STE STEARIC ACID × 60 MYR MYRISTIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 1–305	Not recorded	Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain A； UniProt 1–305	Not recorded	Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STE STEARIC ACID × 5 MYR MYRISTIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain A； UniProt 1–305	Not recorded	Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STE STEARIC ACID × 6 MYR MYRISTIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 1–305	Not recorded	Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9VFR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9VFP Structure of CVA6 empty particle Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain A 1–305（305 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.33 Å
9VFQ Structure of mature CVA6 virus Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.23 Å
9VFS Structure of Coxsackievirus A6 Altered-particles Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain A 1–305（305 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFU Structure of mature CVA6 virus complexed with 1F4 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–305（305 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.11 Å
9VG1 Structure of CVA6 empty capsid complexed with 3H7 Fab Deposited 2025-06-12	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain A 1–305（305 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å

6 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A222NWY2_9ENTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–305； UniProt 1–305

Genome polyprotein

OrganismNot specified

UniProt A0A7D0TR32

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-meric（300） Consistent with protein copy count	Chain B； UniProt 70–325	Not recorded	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STE STEARIC ACID × 60 MYR MYRISTIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain B； UniProt 70–325	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain B； UniProt 70–325	Not recorded	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STE STEARIC ACID × 5 MYR MYRISTIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain B； UniProt 70–325	Not recorded	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STE STEARIC ACID × 6 MYR MYRISTIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain B； UniProt 70–325	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9VFR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9VFP Structure of CVA6 empty particle Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain B 70–325（256 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.33 Å
9VFQ Structure of mature CVA6 virus Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.23 Å
9VFS Structure of Coxsackievirus A6 Altered-particles Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain B 70–325（256 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFU Structure of mature CVA6 virus complexed with 1F4 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain B 70–325（256 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.11 Å
9VG1 Structure of CVA6 empty capsid complexed with 3H7 Fab Deposited 2025-06-12	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain B 70–325（256 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å

6 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A7D0TR32_9ENTO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–256； UniProt 70–325

Genome polyprotein

OrganismNot specified

UniProt A0A4P2SK07

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-meric（300） Consistent with protein copy count	Chain C； UniProt 326–565	Not recorded	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STE STEARIC ACID × 60 MYR MYRISTIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain C； UniProt 326–565	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain C； UniProt 326–565	Not recorded	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STE STEARIC ACID × 5 MYR MYRISTIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain C； UniProt 326–565	Not recorded	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STE STEARIC ACID × 6 MYR MYRISTIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain C； UniProt 326–565	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9VFR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9VFP Structure of CVA6 empty particle Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain C 326–565（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.33 Å
9VFQ Structure of mature CVA6 virus Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.23 Å
9VFS Structure of Coxsackievirus A6 Altered-particles Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain C 326–565（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFU Structure of mature CVA6 virus complexed with 1F4 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain C 326–565（240 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.11 Å
9VG1 Structure of CVA6 empty capsid complexed with 3H7 Fab Deposited 2025-06-12	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain C 326–565（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å

6 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4P2SK07_9ENTO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–240； UniProt 326–565

Genome polyprotein

OrganismNot specified

UniProt E3VJS6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-meric（300） Consistent with protein copy count	Chain D； UniProt 1–69	Not recorded	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Kremen protein 1 × 60 （Q96MU8） STE STEARIC ACID × 60 MYR MYRISTIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain D； UniProt 1–69	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain D； UniProt 1–69	Not recorded	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Kremen protein 1 × 5 （Q96MU8） STE STEARIC ACID × 5 MYR MYRISTIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain D； UniProt 1–69	Not recorded	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Kremen protein 1 × 6 （Q96MU8） STE STEARIC ACID × 6 MYR MYRISTIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain D； UniProt 1–69	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Kremen protein 1 × 1 （Q96MU8） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9VFR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9VFQ Structure of mature CVA6 virus Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.23 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFT Structure of mature CVA6 virus complexed with 3H7 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9VFU Structure of mature CVA6 virus complexed with 1F4 Fab Deposited 2025-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain D 1–69（69 aa）	Not recorded	STE STEARIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.11 Å

3 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E3VJS6_9ENTO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–69； UniProt 1–69

Kremen protein 1

Homo sapiens

UniProt Q96MU8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-meric（300） Consistent with protein copy count	Chain G； UniProt 30–322	Not recorded	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） STE STEARIC ACID × 60 MYR MYRISTIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain G； UniProt 30–322	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain G； UniProt 30–322	Not recorded	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） STE STEARIC ACID × 5 MYR MYRISTIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain G； UniProt 30–322	Not recorded	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） STE STEARIC ACID × 6 MYR MYRISTIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain G； UniProt 30–322	Not recorded	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） STE STEARIC ACID × 1 MYR MYRISTIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.55 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9VFR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5FWS Wnt modulator Kremen crystal form I at 1.90A Deposited 2016-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–373（345 aa） Fragment：ECD, RESIDUES 29-373	Not recorded	SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；2.0 M AMMONIUM SULFATE, 5 %V/V ISO-PROPANOL, pH 7.5	Resolution 1.90 Å R-free 0.227
5FWT Wnt modulator Kremen crystal form I at 2.10A Deposited 2016-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–373（345 aa） Fragment：ECD, RESIDUES 1-473	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；1.000 M (NH4)H2PO4 0.100 M NA3CITRATE PH 5.6	Resolution 2.10 Å R-free 0.232
5FWU Wnt modulator Kremen crystal form II at 2.8A Deposited 2016-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 29–373（345 aa） Fragment：ECD, RESIDUES 29-373	Not recorded	CL CHLORIDE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；0.1 M NA3CITRATE, 1.0 M MGSO4, FINAL PH 5.6	Resolution 2.80 Å R-free 0.307
5FWV Wnt modulator Kremen crystal form III at 3.2A Deposited 2016-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–373（345 aa） Fragment：ECD, RESIDUES 29-373	Not recorded	CL CHLORIDE ION × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES/MOPS 7.5 30 % P550MME_P20K DRIED OUT	Resolution 3.20 Å R-free 0.265
5FWW Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) Deposited 2016-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 30–322（293 aa） Fragment：ECD, RESIDUES 30-322	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；20 %W/V PEG3350 0.2 M NA/K-PHOSPHATE, pH 7.5	Resolution 3.50 Å R-free 0.355
6SNW Structure of Coxsackievirus A10 complexed with its receptor KREMEN1 Deposited 2019-08-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 23–375（353 aa）	Not recorded	SPH SPHINGOSINE × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KREM1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–293； UniProt 30–322

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9vfr
Deposition date deposition_date	2025-06-11
Structure title title	Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1
Keywords keywords	coxsackievirus A6, KRM1, receptor, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.70 Å
Radius of gyration Rg (electron density) rg_electron	33.17 Å
Forward intensity I(0) i0	223557000.00
Molecular weight molecular_weight	120110.0 kDa
Excluded volume excluded_volume	150030 Å³
Envelope volume envelope_volume	187850 Å³
Hydration-shell volume shell_volume	46785 Å³
Envelope diameter envelope_diameter	121.0 Å
Shell Rg shell_rg	40.14 Å
Envelope Rg envelope_rg	33.60 Å
Shape Rg shape_rg	33.17 Å
Total Rg total_rg	33.70 Å
Total atoms total_atoms	8479
Residues n_residues	1119
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	114.2 Å
Rg (real space) rg_real	33.70 Å
Rg uncertainty (real space) rg_real_error	0.92 Å
I(0) (real space) i0_real	2.2360e+08
I(0) uncertainty (real space) i0_real_error	3.7760e+06
Rg (reciprocal space) rg_reciprocal	33.70 Å
I(0) (reciprocal space) i0_reciprocal	223600000.0000
Solution quality estimate total_estimate	0.8794
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	38.9 Å
Skewness Skewness skewness	0.360
Kurtosis Kurtosis kurtosis	-0.278
Angular range angular_range	— – 0.2350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	28770000.0000
Real-space data points n_real_points	48
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.838; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.977; Smooth: 0.937

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	33568.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8479

NDPITNAVESAVSALADTTISRVTAANTAASTHSLGTGRVPALQAAETGASSNSSDENLIETRCVMNRNGVNEASVEHFYSRAGLVGVVEVKDSGTSLDGYTVWPIDVMGFVQQRRKLELSTYMRFDAEFTFVSNLNNSTTPGMLLQYMYVPPGAPKPDSRKSYQWQTATNPSVFAKLSDPPPQVSVPFMSPATAYQWFYDGYPTFGEHKQATNLQYGQCPNNMMGHFAIRTVSESTTGKNIHVRVYMRIKHVRAWVPRPLRSQAYMVKNYPTYSQTITNTATDRASITTTDYEGGVPASPQRTS

Entity 2 Entity 2 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	28138.6 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SPSVEACGYSDRVAQLTVGNSTITTQEAANIVLSYGEWPEYCPSTDATAVDKPTRPDVSVNRFYTLSTKSWKTESTGWYWKFPDVLNDTGVFGQNAQFHYLYRSGFCMHVQCNASKFHQGALLVAAIPEFVIAASSPATKPNSQGLYPDFAHTNPGKDGQEFRDPYVLDAGIPLSQALIFPHQWINLRTNNCATIIMPYINALPFDSALNHSNFGLVVIPISPLKYCNGATTEVPITLTIAPLNSEFSGLRQAIKQ

Entity 3 Entity 3 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	26324.8 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GFPTELKPGTNQFLTTDDGTSPPILPGFEPTPLIHIPGEFTSLLDLCQVETILEVNNTTGTTGVSRLLIPVRAQNNVDQLCASFQVDPGRNGPWQSTMVGQICRYYTQWSGSLKVTFMFTGSFMATGKMLIAYTPPGSAQPTTREAAMLGTHIVWDFGLQSSVTLVIPWISNTHFRAVKTGGVYDYYATGIVTIWYQTNFVVPPDTPTEANIIALGAAQKNFTLKLCKDTDEIQQTAEYQ

Entity 4 Entity 4 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	7503.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGAQVSTQKSGSHETRNVATEGSTINFTNINYYKDSYAASASRQDFAQDPAKFTRPVLDAIREAAAPLQ

Entity 5 Entity 5 polymer

Description description	Kremen protein 1
Molecular weight formula_weight	32728.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 6 Entity 6 non-polymer

Description description	STEARIC ACID
Molecular weight formula_weight	284.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.55 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	19306

fit	/app/data/saxs_computation/vf/9vfr/9vfr.fit
pddf	/app/data/pr_computation/vf/9vfr/9vfr.pr.out
profile	/app/data/saxs_computation/vf/9vfr/9vfr.dat

Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Kremen protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)