9vfr

Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STEARIC ACID × 60 MYRISTIC ACID × 60 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STEARIC ACID × 5 MYRISTIC ACID × 5 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STEARIC ACID × 6 MYRISTIC ACID × 6 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222NWY2_9ENTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–305； UniProt 1–305

Genome polyprotein

OrganismNot specified

UniProt A0A7D0TR32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STEARIC ACID × 60 MYRISTIC ACID × 60 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STEARIC ACID × 5 MYRISTIC ACID × 5 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STEARIC ACID × 6 MYRISTIC ACID × 6 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7D0TR32_9ENTO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–256； UniProt 70–325

Genome polyprotein

OrganismNot specified

UniProt A0A4P2SK07

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （E3VJS6） Kremen protein 1 × 60 （Q96MU8） STEARIC ACID × 60 MYRISTIC ACID × 60 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （E3VJS6） Kremen protein 1 × 5 （Q96MU8） STEARIC ACID × 5 MYRISTIC ACID × 5 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （E3VJS6） Kremen protein 1 × 6 （Q96MU8） STEARIC ACID × 6 MYRISTIC ACID × 6 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （E3VJS6） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4P2SK07_9ENTO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–240； UniProt 326–565

Genome polyprotein

OrganismNot specified

UniProt E3VJS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Kremen protein 1 × 60 （Q96MU8） STEARIC ACID × 60 MYRISTIC ACID × 60 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Kremen protein 1 × 5 （Q96MU8） STEARIC ACID × 5 MYRISTIC ACID × 5 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Kremen protein 1 × 6 （Q96MU8） STEARIC ACID × 6 MYRISTIC ACID × 6 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Kremen protein 1 × 1 （Q96MU8） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E3VJS6_9ENTO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–69； UniProt 1–69

Kremen protein 1

Homo sapiens

UniProt Q96MU8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Genome polyprotein × 60 （A0A222NWY2） Genome polyprotein × 60 （A0A7D0TR32） Genome polyprotein × 60 （A0A4P2SK07） Genome polyprotein × 60 （E3VJS6） STEARIC ACID × 60 MYRISTIC ACID × 60 2-acetamido-2-deoxy-beta-D-glucopyranose × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Genome polyprotein × 5 （A0A222NWY2） Genome polyprotein × 5 （A0A7D0TR32） Genome polyprotein × 5 （A0A4P2SK07） Genome polyprotein × 5 （E3VJS6） STEARIC ACID × 5 MYRISTIC ACID × 5 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Genome polyprotein × 6 （A0A222NWY2） Genome polyprotein × 6 （A0A7D0TR32） Genome polyprotein × 6 （A0A4P2SK07） Genome polyprotein × 6 （E3VJS6） STEARIC ACID × 6 MYRISTIC ACID × 6 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Genome polyprotein × 1 （A0A222NWY2） Genome polyprotein × 1 （A0A7D0TR32） Genome polyprotein × 1 （A0A4P2SK07） Genome polyprotein × 1 （E3VJS6） STEARIC ACID × 1 MYRISTIC ACID × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KREM1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–293； UniProt 30–322

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9vfr
Deposition date deposition_date	2025-06-11
Structure title title	Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1
Keywords keywords	coxsackievirus A6, KRM1, receptor, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9vfr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9vfr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9vfr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	140.70 Å
Total Rg	140.60 Å
Atom count	508740
Residues	67140
Excluded volume	9001800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9vfr__assembly_1__model_1`	300-meric （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9vfr__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`9vfr__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`9vfr__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`9vfr__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	33568.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8479

NDPITNAVESAVSALADTTISRVTAANTAASTHSLGTGRVPALQAAETGASSNSSDENLIETRCVMNRNGVNEASVEHFYSRAGLVGVVEVKDSGTSLDGYTVWPIDVMGFVQQRRKLELSTYMRFDAEFTFVSNLNNSTTPGMLLQYMYVPPGAPKPDSRKSYQWQTATNPSVFAKLSDPPPQVSVPFMSPATAYQWFYDGYPTFGEHKQATNLQYGQCPNNMMGHFAIRTVSESTTGKNIHVRVYMRIKHVRAWVPRPLRSQAYMVKNYPTYSQTITNTATDRASITTTDYEGGVPASPQRTS

Entity 2 Entity 2 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	28138.6 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SPSVEACGYSDRVAQLTVGNSTITTQEAANIVLSYGEWPEYCPSTDATAVDKPTRPDVSVNRFYTLSTKSWKTESTGWYWKFPDVLNDTGVFGQNAQFHYLYRSGFCMHVQCNASKFHQGALLVAAIPEFVIAASSPATKPNSQGLYPDFAHTNPGKDGQEFRDPYVLDAGIPLSQALIFPHQWINLRTNNCATIIMPYINALPFDSALNHSNFGLVVIPISPLKYCNGATTEVPITLTIAPLNSEFSGLRQAIKQ

Entity 3 Entity 3 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	26324.8 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GFPTELKPGTNQFLTTDDGTSPPILPGFEPTPLIHIPGEFTSLLDLCQVETILEVNNTTGTTGVSRLLIPVRAQNNVDQLCASFQVDPGRNGPWQSTMVGQICRYYTQWSGSLKVTFMFTGSFMATGKMLIAYTPPGSAQPTTREAAMLGTHIVWDFGLQSSVTLVIPWISNTHFRAVKTGGVYDYYATGIVTIWYQTNFVVPPDTPTEANIIALGAAQKNFTLKLCKDTDEIQQTAEYQ

Entity 4 Entity 4 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	7503.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGAQVSTQKSGSHETRNVATEGSTINFTNINYYKDSYAASASRQDFAQDPAKFTRPVLDAIREAAAPLQ

Entity 5 Entity 5 polymer

Description description	Kremen protein 1
Molecular weight formula_weight	32728.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 non-polymer

Description description	STEARIC ACID
Molecular weight formula_weight	284.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.55 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	19306

Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Kremen protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9vfr__assembly_1__model_1

9vfr__assembly_1__model_1 | I(q)

9vfr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)