← Back to search

9vm9

Crystal structure of FGFR3 in complex with 10s

Method: X-RAY DIFFRACTION D_max: 115.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9vm9
deposition_date	2025-06-27
last_revision	2026-05-06
title	Crystal structure of FGFR3 in complex with 10s
keywords	FGFR3, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	35.74 Å
rg_electron	35.14 Å
i0	505278000.00
molecular_weight	121050.0 kDa
excluded_volume	116930 Å³
envelope_volume	216740 Å³
shell_volume	50562 Å³
envelope_diameter	122.9 Å
shell_rg	42.36 Å
envelope_rg	34.44 Å
shape_rg	35.13 Å
total_rg	35.53 Å
total_atoms	9143
n_residues	1137
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	115.3 Å
rg_real	35.57 Å
rg_real_error	0.75 Å
i0_real	5.0530e+08
i0_real_error	7.9370e+06
rg_reciprocal	35.68 Å
i0_reciprocal	505300000.0000
total_estimate	0.8996
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	49.8 Å
skewness	0.093
kurtosis	-0.595
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0000
highest_alpha	72820000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.904; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.980

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Fibroblast growth factor receptor 3
formula_weight	32936.1 kDa
ec_number	2.7.10.1
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	9210

GPSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRSGEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	~{N}-[1-methyl-3-[2-[[5-methyl-1-(2-morpholin-4-ylethyl)pyrazol-4-yl]amino]pyrimidin-4-yl]indol-6-yl]propanamide
formula_weight	488.6 kDa
src_method	nat
entity_count	4

Entity 3 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	4

Entity 4 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	55

▶

6. Citations (1)

▶

length_a	58.700 Å
length_b	113.510 Å
length_c	87.900 Å
angle_alpha	90.00 °
angle_beta	94.97 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	2.650 Å
resolution_low	17.930 Å
r_factor	0.2621
r_work	0.2593
r_free	0.3125

fit	/app/data/saxs_computation/vm/9vm9/9vm9.fit
pddf	/app/data/pr_computation/vm/9vm9/9vm9.pr.out
profile	/app/data/saxs_computation/vm/9vm9/9vm9.dat