SAXSdb — 9vzc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Death-on-curing family protein

Enterococcus faecalis V583

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Addiction module antidote × 1 （Q838Q6） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Addiction module antidote × 1 （Q838Q6） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q838Q7_ENTFA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–139； UniProt 1–139 Author chain C； PDBConstruct 1–139； UniProt 1–139

Addiction module antidote

Enterococcus faecalis V583

UniProt Q838Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Death-on-curing family protein × 1 （Q838Q7） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Death-on-curing family protein × 1 （Q838Q7） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q838Q6_ENTFA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–79； UniProt 1–79 Author chain D； PDBConstruct 1–79； UniProt 1–79

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9vzc
Deposition date deposition_date	2025-07-22
Last revision last_revision	2026-05-27
Structure title title	Doc and Phd complex from Enterococcus faecalis
Keywords keywords	Doc and Phd complex, TOXIN; TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9vzc__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9vzc__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9vzc__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.43 Å
Rg (electron density)	15.11 Å
Total Rg	16.27 Å
Atom count	1311
Residues	161
Excluded volume	23460 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9vzc__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9vzc__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Death-on-curing family protein
Molecular weight formula_weight	15930.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	2642

MKSIYYLSADDLFQMNTFLIQTYSPAEQIGIKDRNALEMASNQPAQFVFDVDLYPTIEEKAAILMINIATKHCFYNANKRTAVMATDLFLQLNGYDFQLDTQEGVDLLVFIATYRSDFDQLKNDVSKVIRAKLNHTSSH

Source Source

Source organism organism	Enterococcus faecalis V583
NCBI taxonomy ID ncbi_taxonomy_id	226185
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Addiction module antidote
Molecular weight formula_weight	9287.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MEIKERKLRKVGNSVVMTLSKEFLESIGATATDTVYVDEEKLKDIIVKKNMSEHQKKLQQMMENSKQKHNELYKELVTK

Source Source

Source organism organism	Enterococcus faecalis V583
NCBI taxonomy ID ncbi_taxonomy_id	226185
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	28

▶

Unit-cell length a length_a	38.035 Å
Unit-cell length b length_b	77.278 Å
Unit-cell length c length_c	58.304 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	29.450 Å
R factor r_factor	0.1832
R_work r_work	0.1815
R_free r_free	0.2172

Doc and Phd complex from Enterococcus faecalis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Death-on-curing family protein

State in the Current Structure

Other States of the Same Protein in the Database

Addiction module antidote

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9vzc__assembly_2__model_1

9vzc__assembly_2__model_1 | I(q)

9vzc__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Doc and Phd complex from Enterococcus faecalis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Death-on-curing family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Addiction module antidote

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9vzc__assembly_2__model_1

9vzc__assembly_2__model_1 | I(q)

9vzc__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)