SAXSdb — 9w77

▼

1. Structure Basics

entry_id	9w77
deposition_date	2025-08-05
title	Rhinolophus cornutus Bat ACE2 Dimer in Complex with Two Rc-o319 Sarbecovirus Spike RBDs.
keywords	the complex between sarbecovirus RBD and dimeric ACE2, VIRAL PROTEIN/HYDROLASE, VIRAL PROTEIN-HYDROLASE complex; VIRAL PROTEIN/HYDROLASE
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	45.11 Å
rg_electron	44.77 Å
i0	605042000.00
molecular_weight	202260.0 kDa
excluded_volume	252040 Å³
envelope_volume	353360 Å³
shell_volume	64615 Å³
envelope_diameter	140.7 Å
shell_rg	51.33 Å
envelope_rg	43.63 Å
shape_rg	44.79 Å
total_rg	44.95 Å
total_atoms	14270
n_residues	1695
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	135.3 Å
rg_real	45.00 Å
rg_real_error	1.00 Å
i0_real	6.0500e+08
i0_real_error	9.6140e+06
rg_reciprocal	45.11 Å
i0_reciprocal	605100000.0000
total_estimate	0.6335
solution_quality	REASONABLE a REASONABLE solution
n_peaks	2
r_peak_primary	42.5 Å
skewness	0.126
kurtosis	-0.777
angular_range	— – 0.1750 Å⁻¹
current_alpha	0.0000
highest_alpha	102500000.0000
n_real_points	36
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.974; Stabil: 1.000; Sysdev: 0.010; Positv: 1.000; Valcen: 0.998; Smooth: 0.282

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	Spike protein S1
formula_weight	24401.2 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,D
atom_count	14270

RVQPQDTVVRFPNITNLCPFSEVFNATTFASVYAWNRKRISNCVADYSVLYNSTSFSTFQCYGVSSTKLNDLCFTNVYADSFVVRGDEVRQIAPGQTGVIADYNYKLPDDFTGCVLAWNSRNQDASTSGNFNYYYRIWRSEKLRPFERDIAHYDYQVGTQFKSSLKNYGFYSSAGDSHQPYRVVVLSFELLNAPATVCGPKQSTELIKNKCVNF

Source

organism	Sarbecovirus
ncbi_taxonomy_id	2509511
host_organism	Homo sapiens

Entity 2 polymer

description	Angiotensin-converting enzyme
formula_weight	84844.6 kDa
ec_number	3.4.-.-
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	C,A

MSGSSWLLLSLVAVTAAQSTTEDEAKKFLNDFNSEAENLTYQSSLASWDYNTNISDENVQKMDEAGAKWSAFYEEQSKIAKNYPLEEIQTDIVKRQLQILQQSGSPVLSEDKSKRLNSILNAMSTIYSTGKVCKPNNPQECLLLEPGLDNIMGTSKDYHERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARGYHYEDYGDYWRRDYETEESSGPGYSRDQLMKDVDRIFTEIKPLYEHLHAYVRAKLMDTYPLHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDEMVKQGWDANRIFKEAEKFFVSVGLPNMTEGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMCTKVTMEDFLTAHHEMGHIQYDMAYASQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKTMGLLSPDFREDDETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEMRREIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIFEFQFHEALCRIAQHNGPLHKCDISNSTDAGKKLHQMLSVGKSQAWTKTLEDIVGSRNMDVGPLLRYFEPLYTWLQEQNRKSYVGWNTDWSPYSDQSIKVRISLKSALGEKAYEWNDNEMYLFRSSVAYAMREYFLKTKNQTILFGDENVWVSNLKPRISFNFHVTSPENVSDIIPRSEVEGAIRMSRSRINDAFRLDDNSLEFLGIQPTL

Source

organism	Rhinolophus cornutus
common_name	Little Japanese Horseshoe Bat
ncbi_taxonomy_id	196296
host_organism	Homo sapiens

Entity 3 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	424.4 kDa
src_method	man
entity_count	6

Entity 4 branched

description	;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	910.8 kDa
src_method	man
entity_count	1

Entity 5 branched

description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	910.8 kDa
src_method	man
entity_count	1

Entity 6 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	4

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.400 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	2.40 Å
resolution_method	—
num_particles	493907

fit	/app/data/saxs_computation/w7/9w77/9w77.fit
pddf	/app/data/pr_computation/w7/9w77/9w77.pr.out
profile	/app/data/saxs_computation/w7/9w77/9w77.dat

Rhinolophus cornutus Bat ACE2 Dimer in Complex with Two Rc-o319 Sarbecovirus Spike RBDs.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (6)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 branched

Entity 4 branched

Entity 5 branched

Entity 6 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)