← Back to search

9w78

Rhinolophus cornutus Bat ACE2 Dimer in Complex with Two Rc-o319 Sarbecovirus Spike RBDs.

Method: ELECTRON MICROSCOPY D_max: 124.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9w78
deposition_date	2025-08-05
title	Rhinolophus cornutus Bat ACE2 Dimer in Complex with Two Rc-o319 Sarbecovirus Spike RBDs.
keywords	the complex between sarbecovirus RBD and dimeric ACE2, VIRAL PROTEIN/HYDROLASE, VIRAL PROTEIN-HYDROLASE complex; VIRAL PROTEIN/HYDROLASE
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	33.89 Å
rg_electron	33.64 Å
i0	169184000.00
molecular_weight	103510.0 kDa
excluded_volume	128920 Å³
envelope_volume	166490 Å³
shell_volume	42985 Å³
envelope_diameter	129.2 Å
shell_rg	38.78 Å
envelope_rg	33.78 Å
shape_rg	33.62 Å
total_rg	34.08 Å
total_atoms	7299
n_residues	868
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	124.7 Å
rg_real	34.08 Å
rg_real_error	1.26 Å
i0_real	1.6920e+08
i0_real_error	2.8930e+06
rg_reciprocal	33.96 Å
i0_reciprocal	169200000.0000
total_estimate	0.8159
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	122.0 Å
skewness	0.625
kurtosis	0.264
angular_range	— – 0.2350 Å⁻¹
current_alpha	0.0000
highest_alpha	32550000.0000
n_real_points	48
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.614; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.815; Smooth: 0.946

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Spike protein S1
formula_weight	24401.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	D
atom_count	7299

RVQPQDTVVRFPNITNLCPFSEVFNATTFASVYAWNRKRISNCVADYSVLYNSTSFSTFQCYGVSSTKLNDLCFTNVYADSFVVRGDEVRQIAPGQTGVIADYNYKLPDDFTGCVLAWNSRNQDASTSGNFNYYYRIWRSEKLRPFERDIAHYDYQVGTQFKSSLKNYGFYSSAGDSHQPYRVVVLSFELLNAPATVCGPKQSTELIKNKCVNF

Source

organism	Sarbecovirus
ncbi_taxonomy_id	2509511
host_organism	Homo sapiens

Entity 2 polymer

description	Angiotensin-converting enzyme
formula_weight	84844.6 kDa
ec_number	3.4.-.-
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

MSGSSWLLLSLVAVTAAQSTTEDEAKKFLNDFNSEAENLTYQSSLASWDYNTNISDENVQKMDEAGAKWSAFYEEQSKIAKNYPLEEIQTDIVKRQLQILQQSGSPVLSEDKSKRLNSILNAMSTIYSTGKVCKPNNPQECLLLEPGLDNIMGTSKDYHERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARGYHYEDYGDYWRRDYETEESSGPGYSRDQLMKDVDRIFTEIKPLYEHLHAYVRAKLMDTYPLHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDEMVKQGWDANRIFKEAEKFFVSVGLPNMTEGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMCTKVTMEDFLTAHHEMGHIQYDMAYASQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKTMGLLSPDFREDDETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEMRREIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIFEFQFHEALCRIAQHNGPLHKCDISNSTDAGKKLHQMLSVGKSQAWTKTLEDIVGSRNMDVGPLLRYFEPLYTWLQEQNRKSYVGWNTDWSPYSDQSIKVRISLKSALGEKAYEWNDNEMYLFRSSVAYAMREYFLKTKNQTILFGDENVWVSNLKPRISFNFHVTSPENVSDIIPRSEVEGAIRMSRSRINDAFRLDDNSLEFLGIQPTL

Source

organism	Rhinolophus cornutus
common_name	Little Japanese Horseshoe Bat
ncbi_taxonomy_id	196296
host_organism	Homo sapiens

Entity 3 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	424.4 kDa
src_method	man
entity_count	3

Entity 4 branched

description	;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	1073.0 kDa
src_method	man
entity_count	1

Entity 5 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	2

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.300 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	2.30 Å
resolution_method	—
num_particles	987814

fit	/app/data/saxs_computation/w7/9w78/9w78.fit
pddf	/app/data/pr_computation/w7/9w78/9w78.pr.out
profile	/app/data/saxs_computation/w7/9w78/9w78.dat

Rhinolophus cornutus Bat ACE2 Dimer in Complex with Two Rc-o319 Sarbecovirus Spike RBDs.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 branched

Entity 4 branched

Entity 5 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)