SAXSdb — 9wjw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mannose/fructose/sorbose family PTS transporter subunit IIC

Listeria monocytogenes

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	PTS mannose family transporter subunit IID × 3 （A0A1E8EBU8） Prepeptide GarQ × 1 （H6U5Y1） alpha-D-mannopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S5LAD9_LISMN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–268； UniProt 1–268 Author chain S； PDBConstruct 1–268； UniProt 1–268 Author chain Y； PDBConstruct 1–268； UniProt 1–268

PTS mannose family transporter subunit IID

Listeria monocytogenes

UniProt A0A1E8EBU8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Mannose/fructose/sorbose family PTS transporter subunit IIC × 3 （S5LAD9） Prepeptide GarQ × 1 （H6U5Y1） alpha-D-mannopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1E8EBU8_LISMN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–303； UniProt 1–303 Author chain T； PDBConstruct 1–303； UniProt 1–303 Author chain Z； PDBConstruct 1–303； UniProt 1–303

Prepeptide GarQ

Lactococcus garvieae

UniProt H6U5Y1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Mannose/fructose/sorbose family PTS transporter subunit IIC × 3 （S5LAD9） PTS mannose family transporter subunit IID × 3 （A0A1E8EBU8） alpha-D-mannopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H6U5Y1_9LACT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–50； UniProt 21–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9wjw
Deposition date deposition_date	2025-08-31
Structure title title	Cryo-EM structure of the GarQ-lmYZ complex
Keywords keywords	;antibiotic resistance; antimicrobial peptides; mannose phosphotransferase system; Man-PTS; bacteriocins; non-pediocin-like/class IId bacteriocins; Garvicin Q; GarQ, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9wjw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9wjw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9wjw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.33 Å
Rg (electron density)	39.53 Å
Total Rg	39.99 Å
Atom count	12735
Residues	1689
Excluded volume	233380 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9wjw__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Mannose/fructose/sorbose family PTS transporter subunit IIC
Molecular weight formula_weight	27377.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S,Y
Atom count atom_count	12735

MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLTACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLAVAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGIRIAIPAAALLFIPADSVQSFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQLTLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY

Source Source

Source organism organism	Listeria monocytogenes
NCBI taxonomy ID ncbi_taxonomy_id	1639
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PTS mannose family transporter subunit IID
Molecular weight formula_weight	33402.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T,Z

MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIKKLYKTKEDRSSALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGMMGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGYKAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDWSHLPQGAQGIKTALQQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKISPIIIILGLFVVGIVGHLIGLL

Source Source

Source organism organism	Listeria monocytogenes
NCBI taxonomy ID ncbi_taxonomy_id	1639
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Prepeptide GarQ
Molecular weight formula_weight	5350.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH

Source Source

Source organism organism	Lactococcus garvieae
NCBI taxonomy ID ncbi_taxonomy_id	1363
Host organism host_organism	Lactococcus phage phiL47

Entity 4 Entity 4 non-polymer

Description description	alpha-D-mannopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.960 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.96 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55270

Cryo-EM structure of the GarQ-lmYZ complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mannose/fructose/sorbose family PTS transporter subunit IIC

State in the Current Structure

Other States of the Same Protein in the Database

PTS mannose family transporter subunit IID

State in the Current Structure

Other States of the Same Protein in the Database

Prepeptide GarQ

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9wjw__assembly_1__model_1

9wjw__assembly_1__model_1 | I(q)

9wjw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)

Cryo-EM structure of the GarQ-lmYZ complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mannose/fructose/sorbose family PTS transporter subunit IIC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PTS mannose family transporter subunit IID

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Prepeptide GarQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9wjw__assembly_1__model_1

9wjw__assembly_1__model_1 | I(q)

9wjw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)