SAXSdb — 9x0w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial assembly protein PilQ

Pseudomonas aeruginosa PAO1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain A； UniProt 1–714 Chain B； UniProt 1–714 Chain C； UniProt 1–714 Chain D； UniProt 1–714 Chain E； UniProt 1–714 Chain F； UniProt 1–714 Chain G； UniProt 1–714 Chain H； UniProt 1–714 Chain I； UniProt 1–714 Chain J； UniProt 1–714 Chain K； UniProt 1–714 Chain L； UniProt 1–714 Chain M； UniProt 1–714 Chain N； UniProt 1–714	Not recorded	Multidrug transporter × 14 （Q9I6D5） PHOSPHATIDYLETHANOLAMINE × 14	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.02 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6VE2 Tetradecameric PilQ bound by TsaP heptamer from Pseudomonas aeruginosa Deposited 2019-12-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 1–714（714 aa） Chain B 1–714（714 aa） Chain C 1–714（714 aa） Chain D 1–714（714 aa） Chain E 1–714（714 aa） Chain F 1–714（714 aa） Chain G 1–714（714 aa） Chain H 1–714（714 aa） Chain I 1–714（714 aa） Chain J 1–714（714 aa） Chain K 1–714（714 aa） Chain L 1–714（714 aa） Chain M 1–714（714 aa） Chain N 1–714（714 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.30 Å
6VE3 Tetradecameric PilQ from Pseudomonas aeruginosa Deposited 2019-12-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–714（714 aa） Chain B 1–714（714 aa） Chain C 1–714（714 aa） Chain D 1–714（714 aa） Chain E 1–714（714 aa） Chain F 1–714（714 aa） Chain G 1–714（714 aa） Chain H 1–714（714 aa） Chain I 1–714（714 aa） Chain J 1–714（714 aa） Chain K 1–714（714 aa） Chain L 1–714（714 aa） Chain M 1–714（714 aa） Chain N 1–714（714 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.30 Å
6VE4 Pentadecameric PilQ from Pseudomonas aeruginosa Deposited 2019-12-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–714（714 aa） Chain B 1–714（714 aa） Chain C 1–714（714 aa） Chain D 1–714（714 aa） Chain E 1–714（714 aa） Chain F 1–714（714 aa） Chain G 1–714（714 aa） Chain H 1–714（714 aa） Chain I 1–714（714 aa） Chain J 1–714（714 aa） Chain K 1–714（714 aa） Chain L 1–714（714 aa） Chain M 1–714（714 aa） Chain N 1–714（714 aa） Chain O 1–714（714 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.90 Å
9X0X Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkB in C14 symmetry Deposited 2025-09-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 1–714（714 aa） Chain B 1–714（714 aa） Chain C 1–714（714 aa） Chain D 1–714（714 aa） Chain E 1–714（714 aa） Chain F 1–714（714 aa） Chain G 1–714（714 aa） Chain H 1–714（714 aa） Chain I 1–714（714 aa） Chain J 1–714（714 aa） Chain K 1–714（714 aa） Chain L 1–714（714 aa） Chain M 1–714（714 aa） Chain N 1–714（714 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.45 Å
9X0Y Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkA in C14 symmetry Deposited 2025-09-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 1–714（714 aa） Chain B 1–714（714 aa） Chain C 1–714（714 aa） Chain D 1–714（714 aa） Chain E 1–714（714 aa） Chain F 1–714（714 aa） Chain G 1–714（714 aa） Chain H 1–714（714 aa） Chain I 1–714（714 aa） Chain J 1–714（714 aa） Chain K 1–714（714 aa） Chain L 1–714（714 aa） Chain M 1–714（714 aa） Chain N 1–714（714 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.68 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PILQ_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–714； UniProt 1–714 Author chain B； PDBConstruct 1–714； UniProt 1–714 Author chain C； PDBConstruct 1–714； UniProt 1–714 Author chain D； PDBConstruct 1–714； UniProt 1–714 Author chain E； PDBConstruct 1–714； UniProt 1–714 Author chain F； PDBConstruct 1–714； UniProt 1–714 Author chain G； PDBConstruct 1–714； UniProt 1–714 Author chain H； PDBConstruct 1–714； UniProt 1–714 Author chain I； PDBConstruct 1–714； UniProt 1–714 Author chain J； PDBConstruct 1–714； UniProt 1–714 Author chain K； PDBConstruct 1–714； UniProt 1–714 Author chain L； PDBConstruct 1–714； UniProt 1–714 Author chain M； PDBConstruct 1–714； UniProt 1–714 Author chain N； PDBConstruct 1–714； UniProt 1–714

Multidrug transporter

Pseudomonas aeruginosa PAO1

UniProt Q9I6D5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain O； UniProt 1–114 Chain P； UniProt 1–114 Chain Q； UniProt 1–114 Chain R； UniProt 1–114 Chain S； UniProt 1–114 Chain T； UniProt 1–114 Chain U； UniProt 1–114 Chain V； UniProt 1–114 Chain W； UniProt 1–114 Chain X； UniProt 1–114 Chain Y； UniProt 1–114 Chain Z； UniProt 1–114 Chain a； UniProt 1–114 Chain b； UniProt 1–114	Not recorded	Fimbrial assembly protein PilQ × 14 （P34750） PHOSPHATIDYLETHANOLAMINE × 14	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.02 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9X0X Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkB in C14 symmetry Deposited 2025-09-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain O 1–114（114 aa） Chain P 1–114（114 aa） Chain Q 1–114（114 aa） Chain R 1–114（114 aa） Chain S 1–114（114 aa） Chain T 1–114（114 aa） Chain U 1–114（114 aa） Chain V 1–114（114 aa） Chain W 1–114（114 aa） Chain X 1–114（114 aa） Chain Y 1–114（114 aa） Chain Z 1–114（114 aa） Chain a 1–114（114 aa） Chain b 1–114（114 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.45 Å
9X0Y Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkA in C14 symmetry Deposited 2025-09-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain O 1–114（114 aa） Chain P 1–114（114 aa） Chain Q 1–114（114 aa） Chain R 1–114（114 aa） Chain S 1–114（114 aa） Chain T 1–114（114 aa） Chain U 1–114（114 aa） Chain V 1–114（114 aa） Chain W 1–114（114 aa） Chain X 1–114（114 aa） Chain Y 1–114（114 aa） Chain Z 1–114（114 aa） Chain a 1–114（114 aa） Chain b 1–114（114 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.68 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9I6D5_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain O； PDBConstruct 1–114； UniProt 1–114 Author chain P； PDBConstruct 1–114； UniProt 1–114 Author chain Q； PDBConstruct 1–114； UniProt 1–114 Author chain R； PDBConstruct 1–114； UniProt 1–114 Author chain S； PDBConstruct 1–114； UniProt 1–114 Author chain T； PDBConstruct 1–114； UniProt 1–114 Author chain U； PDBConstruct 1–114； UniProt 1–114 Author chain V； PDBConstruct 1–114； UniProt 1–114 Author chain W； PDBConstruct 1–114； UniProt 1–114 Author chain X； PDBConstruct 1–114； UniProt 1–114 Author chain Y； PDBConstruct 1–114； UniProt 1–114 Author chain Z； PDBConstruct 1–114； UniProt 1–114 Author chain a； PDBConstruct 1–114； UniProt 1–114 Author chain b； PDBConstruct 1–114； UniProt 1–114

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x0w
Deposition date deposition_date	2025-09-30
Structure title title	Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) in C14 symmetry
Keywords keywords	type IV pili, secretin, plug, outer membrane, permeability barrier, antibiotics, drug resistance, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	62.96 Å
Radius of gyration Rg (electron density) rg_electron	62.42 Å
Forward intensity I(0) i0	4515430000.00
Molecular weight molecular_weight	584950.0 kDa
Excluded volume excluded_volume	740420 Å³
Envelope volume envelope_volume	1258500 Å³
Hydration-shell volume shell_volume	164220 Å³
Envelope diameter envelope_diameter	172.7 Å
Shell Rg shell_rg	72.29 Å
Envelope Rg envelope_rg	57.34 Å
Shape Rg shape_rg	62.42 Å
Total Rg total_rg	62.62 Å
Total atoms total_atoms	41118
Residues n_residues	5348
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	161.9 Å
Rg (real space) rg_real	62.26 Å
Rg uncertainty (real space) rg_real_error	0.69 Å
I(0) (real space) i0_real	4.5150e+09
I(0) uncertainty (real space) i0_real_error	7.4330e+07
Rg (reciprocal space) rg_reciprocal	63.54 Å
I(0) (reciprocal space) i0_reciprocal	4525000000.0000
Solution quality estimate total_estimate	0.8397
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	97.2 Å
Skewness Skewness skewness	-0.192
Kurtosis Kurtosis kurtosis	-0.585
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	549300000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.973; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fimbrial assembly protein PilQ
Molecular weight formula_weight	77463.7 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N
Atom count atom_count	41118

MNSGLSRLGIALLAAMFAPALLAADLEKLDVAALPGDRVELKLQFDEPVAAPRGYTIEQPARIALDLPGVQNKLGTKNRELSVGNTRSVTVVEAKDRTRLIINLTALSSYTTRVEGNNLFVVVGNSPAGASVASAAPVKASPAPASYAQPIKPKPYVPAGRAIRNIDFQRGEKGEGNVVIDLSDPTLSPDIQEQGGKIRLDFAKTQLPDALRVRLDVKDFATPVQFVNASAQSDRTSITIEPSGLYDYLVYQTDNRLTVSIKPMTTEDAERRKKDNFAYTGEKLSLNFQDIDVRSVLQLIADFTDLNLVASDTVQGNITLRLQNVPWDQALDLVLKTKGLDKRKLGNVLLVAPADEIAARERQELEAQKQIAELAPLRRELIQVNYAKAADIAKLFQSVTSDGGQEGKEGGRGSITVDDRTNSIIAYQPQERLDELRRIVSQLDIPVRQVMIEARIVEANVGYDKSLGVRWGGAYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSGIGIGFITDNIILDLQLSAMEKTGNGEIVSQPKVVTSDKETAKILKGSEVPYQEASSSGATSTSFKEAALSLEVTPQITPDNRIIVEVKVTKDAPDYQNMLNGVPPINKNEVNAKILVNDGETIVIGGVFSNEQSKSVEKVPFLGELPYLGRLFRRDTVTDRKNELLVFLTPRIMNNQAIAIGR

来源 Source

来源生物 organism	Pseudomonas aeruginosa PAO1
NCBI Class编号 ncbi_taxonomy_id	208964
宿主生物 host_organism	Pseudomonas aeruginosa PAO1

Entity 2 Entity 2 polymer

Description description	Multidrug transporter
Molecular weight formula_weight	11599.3 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b

MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAYAMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGCTTSGYNHDES

来源 Source

来源生物 organism	Pseudomonas aeruginosa PAO1
NCBI Class编号 ncbi_taxonomy_id	208964
宿主生物 host_organism	Pseudomonas aeruginosa PAO1

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	14

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.02 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	18241

fit	/app/data/saxs_computation/x0/9x0w/9x0w.fit
pddf	/app/data/pr_computation/x0/9x0w/9x0w.pr.out
profile	/app/data/saxs_computation/x0/9x0w/9x0w.dat

Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) in C14 symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial assembly protein PilQ

State in the Current Structure

Other States of the Same Protein in the Database

Multidrug transporter

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)