9x69

The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG2_SYNE7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–67； UniProt 1–67 Author chain Y； PDBConstruct 1–67； UniProt 1–67 Author chain Z； PDBConstruct 1–67； UniProt 1–67 Author chain z； PDBConstruct 1–67； UniProt 1–67

ApcG

OrganismNot specified

UniProt Q31RM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RM8_SYNE7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–110； UniProt 1–110 Author chain b； PDBConstruct 1–110； UniProt 1–110

Phycobilisome rod-core linker polypeptide

OrganismNot specified

UniProt Q31LK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31LK9_SYNE7
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–250； UniProt 1–250 Author chain 3； PDBConstruct 1–250； UniProt 1–250 Author chain 4； PDBConstruct 1–250； UniProt 1–250 Author chain 5； PDBConstruct 1–250； UniProt 1–250

Allophycocyanin, beta subunit

OrganismNot specified

UniProt Q31RG1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG1_SYNE7
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–161； UniProt 1–161 Author chain B； PDBConstruct 1–161； UniProt 1–161 Author chain C； PDBConstruct 1–161； UniProt 1–161 Author chain F； PDBConstruct 1–161； UniProt 1–161 Author chain K； PDBConstruct 1–161； UniProt 1–161 Author chain L； PDBConstruct 1–161； UniProt 1–161 Author chain M； PDBConstruct 1–161； UniProt 1–161 Author chain O； PDBConstruct 1–161； UniProt 1–161 Author chain T； PDBConstruct 1–161； UniProt 1–161 Author chain V； PDBConstruct 1–161； UniProt 1–161 Author chain X； PDBConstruct 1–161； UniProt 1–161 Author chain a； PDBConstruct 1–161； UniProt 1–161 Author chain c； PDBConstruct 1–161； UniProt 1–161 Author chain d； PDBConstruct 1–161； UniProt 1–161 Author chain g； PDBConstruct 1–161； UniProt 1–161 Author chain l； PDBConstruct 1–161； UniProt 1–161 Author chain m； PDBConstruct 1–161； UniProt 1–161 Author chain n； PDBConstruct 1–161； UniProt 1–161 Author chain p； PDBConstruct 1–161； UniProt 1–161 Author chain u； PDBConstruct 1–161； UniProt 1–161 Author chain w； PDBConstruct 1–161； UniProt 1–161 Author chain y； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin alpha chain

OrganismNot specified

UniProt Q31RG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG0_SYNE7
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–161； UniProt 1–161 Author chain E； PDBConstruct 1–161； UniProt 1–161 Author chain G； PDBConstruct 1–161； UniProt 1–161 Author chain H； PDBConstruct 1–161； UniProt 1–161 Author chain I； PDBConstruct 1–161； UniProt 1–161 Author chain J； PDBConstruct 1–161； UniProt 1–161 Author chain Q； PDBConstruct 1–161； UniProt 1–161 Author chain R； PDBConstruct 1–161； UniProt 1–161 Author chain U； PDBConstruct 1–161； UniProt 1–161 Author chain W； PDBConstruct 1–161； UniProt 1–161 Author chain e； PDBConstruct 1–161； UniProt 1–161 Author chain f； PDBConstruct 1–161； UniProt 1–161 Author chain h； PDBConstruct 1–161； UniProt 1–161 Author chain i； PDBConstruct 1–161； UniProt 1–161 Author chain j； PDBConstruct 1–161； UniProt 1–161 Author chain k； PDBConstruct 1–161； UniProt 1–161 Author chain r； PDBConstruct 1–161； UniProt 1–161 Author chain s； PDBConstruct 1–161； UniProt 1–161 Author chain v； PDBConstruct 1–161； UniProt 1–161 Author chain x； PDBConstruct 1–161； UniProt 1–161

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q31RF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RF9_SYNE7
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain N； PDBConstruct 1–705； UniProt 1–705 Author chain o； PDBConstruct 1–705； UniProt 1–705

Allophycocyanin, beta subunit

OrganismNot specified

UniProt O50209

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O50209_SYNE7
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain P； PDBConstruct 1–169； UniProt 1–169 Author chain q； PDBConstruct 1–169； UniProt 1–169

Allophycocyanin alpha-B chain

OrganismNot specified

UniProt Q31RP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Phycobilisome rod-core linker polypeptide × 4 （Q31LK9） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） PHYCOCYANOBILIN × 48	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RP7_SYNE7
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain S； PDBConstruct 1–163； UniProt 1–163 Author chain t； PDBConstruct 1–163； UniProt 1–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x69
Deposition date deposition_date	2025-10-15
Last revision last_revision	2026-04-01
Structure title title	The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942
Keywords keywords	phycobilisome PBS, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9x69__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9x69__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9x69__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.16 Å
Rg (electron density)	68.97 Å
Total Rg	69.09 Å
Atom count	73424
Residues	9306
Excluded volume	1310800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9x69__assembly_1__model_1`	58-meric （58）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7821.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,Y,Z,z
Atom count atom_count	73424

MRMFRITACLPSPSKIRTQRELQNTFFTKLVPYDAWFREQQRIQKLGGKIIKVELATGRPNTNTGLL

Entity 2 Entity 2 polymer

Description description	ApcG
Molecular weight formula_weight	11365.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,b

MVLDKLFGKKEKFFLEIDSSAASTETAAVETAVTPVAAAVETPTAAAGVATPEPAATPAPEPVAEETPAKEIPNVTFAADLSVPTINTGRRLPGPSLDPFVQIASEVVRR

Entity 3 Entity 3 polymer

Description description	Phycobilisome rod-core linker polypeptide
Molecular weight formula_weight	28372.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3,4,5

MALPLLNYAPTTQNSRVAGFEVPGDEQPKQYNTEDQYSPVQFDEVIQAAYRQIFFHAFKCDRQTVLESQLRNGQITVRDFIRGLLLSATFRSSFYDKNSNYRFVEQVVQRVLGRDVYGEREKIAWSLAVATQGYEGFIDTLLNSDEYLSNFGYDKVPYQRRRVLPGRALGETPFNIKSPRYDSYYRTILGFPKAVFAGGPGKRFPAQYLSAKAGDPGAYLALARSIGARGQALSASADIDYLSKVPYRKR

Entity 4 Entity 4 polymer

Description description	Allophycocyanin, beta subunit
Molecular weight formula_weight	17408.7 kDa
Source method src_method	nat
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,F,K,L,M,O,T,V,X,a,c,d,g,l,m,n,p,u,w,y

MQDAITAVINASDVQGKYLDSSALDRLKSYFQSGELRVRAAATISANSALIVKEAVAKSLLYSDITRPGGNMYTTRRYAACIRDLEYYLRYATYAMLAGDTSILDERVLNGLKETYNSLGVPIGATVQAIQAIKEVTASLVGPDAGREMGVYLDYISSGLS

Entity 5 Entity 5 polymer

Description description	Allophycocyanin alpha chain
Molecular weight formula_weight	17439.7 kDa
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,G,H,I,J,Q,R,U,W,e,f,h,i,j,k,r,s,v,x

MSIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLGTPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS

Entity 6 Entity 6 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	78910.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,o

MTVTASGGSSLARPQLYQTVPGSTIVQAEQQDRFPQQGELRELSSYFQSGLKRLAIAEIITRNSDTIVSRAANRIFVGGSPLAYIERPKVDPRNLRSAEEQRAREAKLGTVTFVESSGGGGFFSGLTAALGGAGAVRIPSGFRPINVARYGPRNMQKSLRDMSWFLRYITYAIVAGDPNILVVNVRGLREIIEKACSTPATLVALQDMRATSAGYFRNDPEAQQLVKDYFDVLIREFEAPTPSLKQRQRFAEDQQGLALPQSYANAAERRPKFVIKSTLSTVEKNEAIKAAYRQVFERDITRAYSQKVSDLESKVKNGEISTKEFIRRLGKSPLYRQQFHDRFVNSRVIELAFRHFLGRGISSAEEFTRYFDLLSAKGFAALIDALVDSQEYADYFGEETVPYLRGLGQEAQECRNWGVQQELFKYSAPFVKVPQFVTLFGEYKQPLLDQHPYGAGNDPLEIQFGAIFPSRTVNNRTNPAPFGKDTRRLLVSKGGVNNQVGSAAFQQSGTTPTKIFKLTQVAAGSSSIRSKSVGNPSIRQTESTTQAVIRAAYRQVFGRDLYEGQRLTVPEIKLENGEITVREFVRQIAKSETFRKLYWNNLYVVKAVEYIHRRLLGRPTTGRAEINAYFDISAKKGFYALVDAILDSPEYIAAFGEDTVPYERYITPKGLALRSVRGLEASEKVKASLRPAAGAQERRPEVGRR

Entity 7 Entity 7 polymer

Description description	Allophycocyanin, beta subunit
Molecular weight formula_weight	18590.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,q

MRDAVSSLIAGYDLAGKYLDRNAVDSLRAYFAEGNARVQAAEIINANAASLVRDASAQLFEEVPELLRPGGNAYTTRRYSACLRDLDYYLRYATYALVAGNTEVLDERVLQGLRETYTSLGVPSGPTVRGIAILRDRVRQLVEQAGISNAAFVEVPFDHLGRNLAEQDI

Entity 8 Entity 8 polymer

Description description	Allophycocyanin alpha-B chain
Molecular weight formula_weight	18149.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,t

MTIVSQVILKADDELRYPSGGELKNITDFFKTGEQRLRIAQVLSDSEKKIVDQASRKLWQRRPDFIAPGGNAYGQRQRAQCLRDYGWYLRLITYGVLAGDKEPIESIGLLGAREMYNSLGVPLPGMAEAIRTLKEASLALLSSADATVAAPYFDFLIQGMETI

Entity 9 Entity 9 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	48

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	258722

The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ApcG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin, beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin, beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha-B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9x69__assembly_1__model_1

9x69__assembly_1__model_1 | I(q)

9x69__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer