← Back to search

9x7s

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain

Method: ELECTRON MICROSCOPY D_max: 250.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x7s
deposition_date	2025-10-17
title	sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain
keywords	Filament, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	76.93 Å
rg_electron	76.82 Å
i0	7410790000.00
molecular_weight	715470.0 kDa
excluded_volume	890320 Å³
envelope_volume	1802800 Å³
shell_volume	193070 Å³
envelope_diameter	239.1 Å
shell_rg	81.37 Å
envelope_rg	71.73 Å
shape_rg	76.84 Å
total_rg	76.83 Å
total_atoms	50274
n_residues	6218
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	250.3 Å
rg_real	76.57 Å
rg_real_error	2.31 Å
i0_real	7.4110e+09
i0_real_error	1.8570e+08
rg_reciprocal	78.01 Å
i0_reciprocal	7432000000.0000
total_estimate	0.8496
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	100.1 Å
skewness	0.010
kurtosis	-0.633
angular_range	— – 0.1000 Å⁻¹
current_alpha	0.0000
highest_alpha	612500000.0000
n_real_points	21
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.865; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.941; Smooth: 0.505

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Flagellin
formula_weight	31415.6 kDa
src_method	nat
entity_count	11

Polymer

type	polypeptide(L)
strand_id	A,D,G,J,M,P,S,V,Y,b,e
atom_count	50274

MIINHNVSAIFAHRTLKSNDANLSKDIEKLSSGMRINKAGDDASGLAVSEKMRTQIAGLRRAEQNTEDGMSLIQTAEGYLQETHEIVQRVRVLAVQAANGIYSEEDRQQIQVEVSQLVDEIDRIASQAEFNKMKLLTGAFARLNPTASMWFHIGANMHQRERVYIETMNTAALGLRNPTVLTFISLSTAGKANSVIGLCDDALRVISKQRADLGAYYNRMEHAAKGLMNAYENTQASESRIRDTDMAEQMTSFTRYQILTQAATSMLAQANMKSQSVMRLLQ

Entity 2 polymer

description	Bacterial flagellar sheath protein
formula_weight	35876.8 kDa
src_method	nat
entity_count	7

Polymer

type	polypeptide(L)
strand_id	B,K,N,Q,Z,c,f

MKIIKYLLILQLVSGFSVLFAQTQPANAQESQAAKDQVDELLKGELVPENDDAELTEDQKKKKKEIMEQESLWKNPDFKGYNKTFQELHQLSKTFANNQFRLALSNYQSGVNTIMKNRDWVEQYRKEEAEKKRLDEKWYWQKVDRKAREERVVYREKMKAKQDALNYFSKAINHLDEIKNPDLRERPEFKRLLSDVYRSWIMAEYDLQNLPQTIPILELYIEIDDNEKEYPAHKYLASAYSFEENMIKKTKGPDDMLFKYRYKKNVHLLRATELKYGKDSPEYKHIVNVINRDEVISVAQ

Entity 3 polymer

description	Bacterial flagellar sheath protein
formula_weight	31565.7 kDa
src_method	nat
entity_count	6

Polymer

type	polypeptide(L)
strand_id	L,O,R,a,d,g

MKIKLILPILLLSIGVFAQTGSSETGSTSAGIDPSQSGKSMADTEKELDDNISEVNKRLRLHTVLFKMKVRTLPHKTVLYKGKPSADGERCEAADKQEAQDNTCLHLEVFDFVGSEDGKSSKNLGAKFKKMELFFEGSNNADPDPRKEQPRNLTKIRTYIYQNNFLLEDKVISVIADVAPNGEPAHNDKIELFYQHDDYPVWGTPETPSEKGVGKYILSNVENTKSNPIRNNFKKQFYFKNLDYFDKLFTKIFDYNDRDSNKHYKKNVEALKGSLKY

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	2.83 Å
resolution_method	—
num_particles	2667344

fit	/app/data/saxs_computation/x7/9x7s/9x7s.fit
pddf	/app/data/pr_computation/x7/9x7s/9x7s.pr.out
profile	/app/data/saxs_computation/x7/9x7s/9x7s.dat

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Entity 2 polymer

Polymer

Entity 3 polymer

Polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)