SAXSdb — 9x7s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Bacterial flagellar sheath protein × 7 （B0STJ8） Bacterial flagellar sheath protein × 6 （B0SR03）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B0SQZ5_LEPBP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–282； UniProt 1–282 Author chain D； PDBConstruct 1–282； UniProt 1–282 Author chain G； PDBConstruct 1–282； UniProt 1–282 Author chain J； PDBConstruct 1–282； UniProt 1–282 Author chain M； PDBConstruct 1–282； UniProt 1–282 Author chain P； PDBConstruct 1–282； UniProt 1–282 Author chain S； PDBConstruct 1–282； UniProt 1–282 Author chain V； PDBConstruct 1–282； UniProt 1–282 Author chain Y； PDBConstruct 1–282； UniProt 1–282 Author chain b； PDBConstruct 1–282； UniProt 1–282 Author chain e； PDBConstruct 1–282； UniProt 1–282

Bacterial flagellar sheath protein

OrganismNot specified

UniProt B0STJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Flagellin × 11 （B0SQZ5） Bacterial flagellar sheath protein × 6 （B0SR03）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B0STJ8_LEPBP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–300； UniProt 1–300 Author chain K； PDBConstruct 1–300； UniProt 1–300 Author chain N； PDBConstruct 1–300； UniProt 1–300 Author chain Q； PDBConstruct 1–300； UniProt 1–300 Author chain Z； PDBConstruct 1–300； UniProt 1–300 Author chain c； PDBConstruct 1–300； UniProt 1–300 Author chain f； PDBConstruct 1–300； UniProt 1–300

Bacterial flagellar sheath protein

OrganismNot specified

UniProt B0SR03

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Flagellin × 11 （B0SQZ5） Bacterial flagellar sheath protein × 7 （B0STJ8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B0SR03_LEPBP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 1–277； UniProt 1–277 Author chain O； PDBConstruct 1–277； UniProt 1–277 Author chain R； PDBConstruct 1–277； UniProt 1–277 Author chain a； PDBConstruct 1–277； UniProt 1–277 Author chain d； PDBConstruct 1–277； UniProt 1–277 Author chain g； PDBConstruct 1–277； UniProt 1–277

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x7s
Deposition date deposition_date	2025-10-17
Structure title title	sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain
Keywords keywords	Filament, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9x7s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9x7s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9x7s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.93 Å
Rg (electron density)	76.82 Å
Total Rg	76.83 Å
Atom count	50274
Residues	6218
Excluded volume	890320 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9x7s__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellin
Molecular weight formula_weight	31415.6 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P,S,V,Y,b,e
Atom count atom_count	50274

MIINHNVSAIFAHRTLKSNDANLSKDIEKLSSGMRINKAGDDASGLAVSEKMRTQIAGLRRAEQNTEDGMSLIQTAEGYLQETHEIVQRVRVLAVQAANGIYSEEDRQQIQVEVSQLVDEIDRIASQAEFNKMKLLTGAFARLNPTASMWFHIGANMHQRERVYIETMNTAALGLRNPTVLTFISLSTAGKANSVIGLCDDALRVISKQRADLGAYYNRMEHAAKGLMNAYENTQASESRIRDTDMAEQMTSFTRYQILTQAATSMLAQANMKSQSVMRLLQ

Entity 2 Entity 2 polymer

Description description	Bacterial flagellar sheath protein
Molecular weight formula_weight	35876.8 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,K,N,Q,Z,c,f

MKIIKYLLILQLVSGFSVLFAQTQPANAQESQAAKDQVDELLKGELVPENDDAELTEDQKKKKKEIMEQESLWKNPDFKGYNKTFQELHQLSKTFANNQFRLALSNYQSGVNTIMKNRDWVEQYRKEEAEKKRLDEKWYWQKVDRKAREERVVYREKMKAKQDALNYFSKAINHLDEIKNPDLRERPEFKRLLSDVYRSWIMAEYDLQNLPQTIPILELYIEIDDNEKEYPAHKYLASAYSFEENMIKKTKGPDDMLFKYRYKKNVHLLRATELKYGKDSPEYKHIVNVINRDEVISVAQ

Entity 3 Entity 3 polymer

Description description	Bacterial flagellar sheath protein
Molecular weight formula_weight	31565.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,O,R,a,d,g

MKIKLILPILLLSIGVFAQTGSSETGSTSAGIDPSQSGKSMADTEKELDDNISEVNKRLRLHTVLFKMKVRTLPHKTVLYKGKPSADGERCEAADKQEAQDNTCLHLEVFDFVGSEDGKSSKNLGAKFKKMELFFEGSNNADPDPRKEQPRNLTKIRTYIYQNNFLLEDKVISVIADVAPNGEPAHNDKIELFYQHDDYPVWGTPETPSEKGVGKYILSNVENTKSNPIRNNFKKQFYFKNLDYFDKLFTKIFDYNDRDSNKHYKKNVEALKGSLKY

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.83 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	2667344

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellin

State in the Current Structure

Other States of the Same Protein in the Database

Bacterial flagellar sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Bacterial flagellar sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9x7s__assembly_1__model_1

9x7s__assembly_1__model_1 | I(q)

9x7s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa from the flaA2-complemented stain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bacterial flagellar sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bacterial flagellar sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9x7s__assembly_1__model_1

9x7s__assembly_1__model_1 | I(q)

9x7s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)