← Back to search

9x80

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa wild type

Method: ELECTRON MICROSCOPY D_max: 274.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x80
deposition_date	2025-10-18
title	sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa wild type
keywords	Filament, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	76.36 Å
rg_electron	76.23 Å
i0	6811920000.00
molecular_weight	684370.0 kDa
excluded_volume	851190 Å³
envelope_volume	1741100 Å³
shell_volume	188750 Å³
envelope_diameter	235.4 Å
shell_rg	80.27 Å
envelope_rg	71.05 Å
shape_rg	76.24 Å
total_rg	76.25 Å
total_atoms	48078
n_residues	5961
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	274.7 Å
rg_real	79.32 Å
rg_real_error	1.75 Å
i0_real	6.8160e+09
i0_real_error	1.4550e+08
rg_reciprocal	77.42 Å
i0_reciprocal	6831000000.0000
total_estimate	0.8962
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	109.9 Å
skewness	0.340
kurtosis	0.095
angular_range	— – 0.1000 Å⁻¹
current_alpha	0.9748
highest_alpha	569200000.0000
n_real_points	21
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.741; Stabil: 0.883; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.833

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Flagellin
formula_weight	31415.6 kDa
src_method	nat
entity_count	11

Polymer

type	polypeptide(L)
strand_id	A,D,G,J,M,P,S,V,Y,b,e
atom_count	48078

MIINHNVSAIFAHRTLKSNDANLSKDIEKLSSGMRINKAGDDASGLAVSEKMRTQIAGLRRAEQNTEDGMSLIQTAEGYLQETHEIVQRVRVLAVQAANGIYSEEDRQQIQVEVSQLVDEIDRIASQAEFNKMKLLTGAFARLNPTASMWFHIGANMHQRERVYIETMNTAALGLRNPTVLTFISLSTAGKANSVIGLCDDALRVISKQRADLGAYYNRMEHAAKGLMNAYENTQASESRIRDTDMAEQMTSFTRYQILTQAATSMLAQANMKSQSVMRLLQ

Entity 2 polymer

description	Bacterial flagellar sheath protein
formula_weight	35876.8 kDa
src_method	nat
entity_count	6

Polymer

type	polypeptide(L)
strand_id	K,N,Q,Z,c,f

MKIIKYLLILQLVSGFSVLFAQTQPANAQESQAAKDQVDELLKGELVPENDDAELTEDQKKKKKEIMEQESLWKNPDFKGYNKTFQELHQLSKTFANNQFRLALSNYQSGVNTIMKNRDWVEQYRKEEAEKKRLDEKWYWQKVDRKAREERVVYREKMKAKQDALNYFSKAINHLDEIKNPDLRERPEFKRLLSDVYRSWIMAEYDLQNLPQTIPILELYIEIDDNEKEYPAHKYLASAYSFEENMIKKTKGPDDMLFKYRYKKNVHLLRATELKYGKDSPEYKHIVNVINRDEVISVAQ

Entity 3 polymer

description	Bacterial flagellar sheath protein
formula_weight	31565.7 kDa
src_method	nat
entity_count	6

Polymer

type	polypeptide(L)
strand_id	L,O,R,a,d,g

MKIKLILPILLLSIGVFAQTGSSETGSTSAGIDPSQSGKSMADTEKELDDNISEVNKRLRLHTVLFKMKVRTLPHKTVLYKGKPSADGERCEAADKQEAQDNTCLHLEVFDFVGSEDGKSSKNLGAKFKKMELFFEGSNNADPDPRKEQPRNLTKIRTYIYQNNFLLEDKVISVIADVAPNGEPAHNDKIELFYQHDDYPVWGTPETPSEKGVGKYILSNVENTKSNPIRNNFKKQFYFKNLDYFDKLFTKIFDYNDRDSNKHYKKNVEALKGSLKY

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	3.24 Å
resolution_method	—
num_particles	163413

fit	/app/data/saxs_computation/x8/9x80/9x80.fit
pddf	/app/data/pr_computation/x8/9x80/9x80.pr.out
profile	/app/data/saxs_computation/x8/9x80/9x80.dat

sheathed filament of the spirochete periplasmic flagella of Leptospira biflexa wild type

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Entity 2 polymer

Polymer

Entity 3 polymer

Polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)