← Back to search

9xf5

Cycloisomaltooligosaccharide binding protein in complex with cycloisomaltooctaose

Method: X-RAY DIFFRACTION D_max: 71.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9xf5
deposition_date	2025-10-28
title	Cycloisomaltooligosaccharide binding protein in complex with cycloisomaltooctaose
keywords	Complex, Solute binding protein, oligosaccharides, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	22.15 Å
rg_electron	21.08 Å
i0	28633600.00
molecular_weight	42748.0 kDa
excluded_volume	54117 Å³
envelope_volume	60903 Å³
shell_volume	23904 Å³
envelope_diameter	71.6 Å
shell_rg	28.00 Å
envelope_rg	21.24 Å
shape_rg	21.06 Å
total_rg	22.01 Å
total_atoms	3013
n_residues	380
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	71.5 Å
rg_real	22.06 Å
rg_real_error	0.35 Å
i0_real	2.8630e+07
i0_real_error	3.8840e+05
rg_reciprocal	22.08 Å
i0_reciprocal	28630000.0000
total_estimate	0.8941
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	25.6 Å
skewness	0.265
kurtosis	-0.411
angular_range	— – 0.3600 Å⁻¹
current_alpha	0.0000
highest_alpha	9314000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.882; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.998; Smooth: 0.976

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	ABC transporter substrate-binding protein
formula_weight	48528.8 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3425

MKRFFQFMLITLLIVSMAAISFGCAKSEETTEGNNTGNEQTNASNQEETIKEPVTIEFWHTYSDTEEVIFNEQVLPLFEEKYPNIKVTSTRMPYEGLKQQVIAGVAGDAAPDLMRMDIIWVPEFAKLGALMSLDDMDGFGDVSGQLFPGPLATNYYNGKYYGLPLNTNTKVAIYNKELLAEAGLTEAPKTFDQLIEASKALKAKGKFGIGIGGTGPWGSLPYFWSLGGKITDENFTKASGYLNSPESIAALEKIVELNNEGLIAPTLLGGEPGTWDGVKEQYLMIDDGPWFYSILGDEALEITTPALMPEGDGGSVSVVGGEDLVMFNTTKHPEEAWTFMKFLMTEEPQKIMAQTGLIPTNQQAAGSTEVLSVPFIKPYIEQLKTAQPRTPHPNWVKIEESLDLAFGKAVRGEMGAKEALDQAAKEIDEFLKLEHHHHHH

Source

organism	Tepidibacillus decaturensis
ncbi_taxonomy_id	1413211
host_organism	Escherichia coli BL21(DE3)

Entity 2 branched

description	Cyclooctakis-(1-6)-(alpha-D-glucopyranose)
formula_weight	1315.1 kDa
src_method	man
entity_count	1

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	412

▶

6. Citations (1)

▶

length_a	69.330 Å
length_b	78.940 Å
length_c	83.398 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	1.600 Å
resolution_low	44.180 Å
r_factor	0.1706
r_work	0.1693
r_free	0.1961

fit	/app/data/saxs_computation/xf/9xf5/9xf5.fit
pddf	/app/data/pr_computation/xf/9xf5/9xf5.pr.out
profile	/app/data/saxs_computation/xf/9xf5/9xf5.dat

Cycloisomaltooligosaccharide binding protein in complex with cycloisomaltooctaose

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction