SAXSdb — 9xfu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ABC transporter substrate-binding protein

Tepidibacillus decaturensis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Monomer	Protein 1 其他Polymer 1	;alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose ; × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A135L7T9_9BACI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 8–432； UniProt 1–425

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9xfu
Deposition date deposition_date	2025-10-29
Structure title title	Cycloisomaltooligosaccharide binding protein in complex with isomaltoheptaose
Keywords keywords	Complex, Solute binding protein, oligosaccharides, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9xfu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9xfu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9xfu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.72 Å
Rg (electron density)	21.65 Å
Total Rg	22.59 Å
Atom count	3058
Residues	390
Excluded volume	54802 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9xfu__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ABC transporter substrate-binding protein
Molecular weight formula_weight	48528.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3426

MKRFFQFMLITLLIVSMAAISFGCAKSEETTEGNNTGNEQTNASNQEETIKEPVTIEFWHTYSDTEEVIFNEQVLPLFEEKYPNIKVTSTRMPYEGLKQQVIAGVAGDAAPDLMRMDIIWVPEFAKLGALMSLDDMDGFGDVSGQLFPGPLATNYYNGKYYGLPLNTNTKVAIYNKELLAEAGLTEAPKTFDQLIEASKALKAKGKFGIGIGGTGPWGSLPYFWSLGGKITDENFTKASGYLNSPESIAALEKIVELNNEGLIAPTLLGGEPGTWDGVKEQYLMIDDGPWFYSILGDEALEITTPALMPEGDGGSVSVVGGEDLVMFNTTKHPEEAWTFMKFLMTEEPQKIMAQTGLIPTNQQAAGSTEVLSVPFIKPYIEQLKTAQPRTPHPNWVKIEESLDLAFGKAVRGEMGAKEALDQAAKEIDEFLKLEHHHHHH

Source Source

Source organism organism	Tepidibacillus decaturensis
NCBI taxonomy ID ncbi_taxonomy_id	1413211
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 branched

Description description	;alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose ;
Molecular weight formula_weight	828.7 kDa
Source method src_method	man
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	368

▶

Unit-cell length a length_a	62.287 Å
Unit-cell length b length_b	68.703 Å
Unit-cell length c length_c	108.414 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	46.150 Å
R factor r_factor	0.1689
R_work r_work	0.1673
R_free r_free	0.2002

Cycloisomaltooligosaccharide binding protein in complex with isomaltoheptaose

1. Protein Identity and Related Structures Protein Identity & Related Structures

ABC transporter substrate-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9xfu__assembly_1__model_1

9xfu__assembly_1__model_1 | I(q)

9xfu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 water

7. Citations (1)

Cycloisomaltooligosaccharide binding protein in complex with isomaltoheptaose

1. Protein Identity and Related Structures Protein Identity & Related Structures

ABC transporter substrate-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9xfu__assembly_1__model_1

9xfu__assembly_1__model_1 | I(q)

9xfu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 water

7. Citations (1)