← Back to search

9xkt

;Crystal structure of the complex of the GH16 carrageenase SfGH16 from Saccharicrinis fermentans with an oligotetrasaccharide of iota-carrageenan ;

Method: X-RAY DIFFRACTION D_max: 60.6 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9xkt
deposition_date	2025-11-06
last_revision	2026-03-04
title	;Crystal structure of the complex of the GH16 carrageenase SfGH16 from Saccharicrinis fermentans with an oligotetrasaccharide of iota-carrageenan ;
keywords	glycoside hydrolase, GH16 family, carrageenase, complex, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	18.78 Å
rg_electron	17.70 Å
i0	17014500.00
molecular_weight	30824.0 kDa
excluded_volume	38319 Å³
envelope_volume	42140 Å³
shell_volume	19444 Å³
envelope_diameter	61.6 Å
shell_rg	24.53 Å
envelope_rg	18.10 Å
shape_rg	17.68 Å
total_rg	18.70 Å
total_atoms	2176
n_residues	261
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	60.6 Å
rg_real	18.66 Å
rg_real_error	0.30 Å
i0_real	1.7010e+07
i0_real_error	2.1920e+05
rg_reciprocal	18.68 Å
i0_reciprocal	17010000.0000
total_estimate	0.8834
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.1 Å
skewness	0.163
kurtosis	-0.362
angular_range	— – 0.4250 Å⁻¹
current_alpha	0.0000
highest_alpha	6963000.0000
n_real_points	74
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.839; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.970

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Kappa-carrageenase
formula_weight	32370.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2657

GSSHHHHHHSSGLVPRGSHMQQPFGLSGNWELQNALSDEFNGGLNTGKWEHDPADWGPWSWKPERTKVSNGKLKLTLDWDKHIRGGEQLYFTSGIIRSKQSIKYGYFEVKMKGAPQHPGVCPAFWTYSIGQPAIVYNGQTIKYNEIDFPEIQQRLRNVKLIDWNVIRADATGKRTSVRETTGGGVGPSFDPRSGYHIYGCLWEKDNIEFYIDGALVATADPTESIYQFHQQHLVISLGLREPYYEYINGQRKAIKTESRPAGFPTTMQVEYVRTWKRSTEGTNT

Source

organism	Saccharicrinis fermentans DSM 9555 = JCM 21142
ncbi_taxonomy_id	869213
host_organism	Escherichia coli

Entity 2 branched

description	;3,6-anhydro-2-O-sulfo-alpha-D-galactopyranose-(1-3)-4-O-sulfo-beta-D-galactopyranose-(1-4)-3,6-anhydro-2-O-sulfo-alpha-D-galactopyranose-(1-3)-4-O-sulfo-beta-D-galactopyranose ;
formula_weight	950.8 kDa
src_method	syn
entity_count	1

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	481

▶

6. Citations (1)

▶

length_a	57.692 Å
length_b	67.878 Å
length_c	84.465 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.440 Å
resolution_low	35.860 Å
r_factor	0.1489
r_work	0.1480
r_free	0.1753

fit	/app/data/saxs_computation/xk/9xkt/9xkt.fit
pddf	/app/data/pr_computation/xk/9xkt/9xkt.pr.out
profile	/app/data/saxs_computation/xk/9xkt/9xkt.dat

;Crystal structure of the complex of the GH16 carrageenase SfGH16 from Saccharicrinis fermentans with an oligotetrasaccharide of iota-carrageenan ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction