SAXSdb — 9ycl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replicase polyprotein 1ab

Middle East respiratory syndrome-related coronavirus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Homooligomer Protein × 4 RNA 2 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain A； UniProt 4238–4377 Chain B； UniProt 5909–6432 Chain D； UniProt 4238–4377 Chain E； UniProt 5909–6432	Mutation：E191A	T20P15 RNA × 2 ZN ZINC ION × 10 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YCL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4WUR The crystal structure of the MERS-CoV papain-like protease (C111S) with human ubiquitin Deposited 2014-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1482–1801（320 aa） Fragment：UNP residues 1482-1801	Mutation：C111S	IPA ISOPROPYL ALCOHOL × 2 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；291 K；22% w/v PEG 4000, 15% v/v 2-propanol, 0.1M tri-sodium citrate pH 4.8 and 10% glycerol	Resolution 3.16 Å R-free 0.252
8PPL MERS-CoV Nsp1 bound to the human 43S pre-initiation complex Deposited 2023-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 52-meric	Chain Aj 2–193（192 aa）	Not recorded	ZN ZINC ION × 4 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 116 MET METHIONINE × 1 UNX UNKNOWN LIGAND × 129	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.65 Å
9INM Crystal structure of MERS main protease in complex with Bofutrelvir Deposited 2024-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3248–3548（301 aa） Chain D 3248–3548（301 aa）	Not recorded	FHR ~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]propan-2-yl]-1~{H}-indole-2-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2M Sodium formate, 0.1M BICINE pH8.5 20% PEG5000	Resolution 2.34 Å R-free 0.275
9INM Crystal structure of MERS main protease in complex with Bofutrelvir Deposited 2024-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 3248–3548（301 aa） Chain C 3248–3548（301 aa）	Not recorded	FHR ~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]propan-2-yl]-1~{H}-indole-2-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2M Sodium formate, 0.1M BICINE pH8.5 20% PEG5000	Resolution 2.34 Å R-free 0.275
9PAC Crystal structure of MERS-CoV 3CLpro with ALG-097608 (Inhibitor 1) Deposited 2025-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 3248–3553（306 aa） Chain D 3248–3553（306 aa）	Not recorded	A1CHF (1R,2R,3S,6S,7S)-4-[(2S)-3,3-dimethyl-2-(2,2,2-trifluoroacetamido)butanoyl]-10,10-difluoro-N-{(1E,2R)-1-imino-3-[(3R)-2-oxo-3,4-dihydro-2H-pyrrol-3-yl]propan-2-yl}-4-azatricyclo[5.2.1.0~2,6~]decane-3-carboxamide (non-preferred name) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2M NaCl, Sodium/Potassium Phosphate 6.2, and 18% PEG1000	Resolution 2.28 Å R-free 0.269
9PAC Crystal structure of MERS-CoV 3CLpro with ALG-097608 (Inhibitor 1) Deposited 2025-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3248–3553（306 aa） Chain B 3248–3553（306 aa）	Not recorded	A1CHF (1R,2R,3S,6S,7S)-4-[(2S)-3,3-dimethyl-2-(2,2,2-trifluoroacetamido)butanoyl]-10,10-difluoro-N-{(1E,2R)-1-imino-3-[(3R)-2-oxo-3,4-dihydro-2H-pyrrol-3-yl]propan-2-yl}-4-azatricyclo[5.2.1.0~2,6~]decane-3-carboxamide (non-preferred name) × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2M NaCl, Sodium/Potassium Phosphate 6.2, and 18% PEG1000	Resolution 2.28 Å R-free 0.269
9PAK Crystal structure of MERS-CoV 3CLpro with ALG-097655 (Inhibitor 2) Deposited 2025-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3248–3553（306 aa） Chain B 3248–3553（306 aa）	Not recorded	A1CHJ (1R,2S,3S,6R,7S)-N-{(1Z,2S)-1-imino-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}-4-[(2S)-4,4,4-trifluoro-3,3-dimethyl-2-(2,2,2-trifluoroacetamido)butanoyl]-4-azatricyclo[5.2.1.0~2,6~]dec-8-ene-3-carboxamide (non-preferred name) × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2M NaCl, Sodium/Potassium Phosphate 6.2, and 18% PEG1000	Resolution 1.86 Å R-free 0.239
9PAK Crystal structure of MERS-CoV 3CLpro with ALG-097655 (Inhibitor 2) Deposited 2025-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 3248–3553（306 aa） Chain D 3248–3553（306 aa）	Not recorded	A1CHJ (1R,2S,3S,6R,7S)-N-{(1Z,2S)-1-imino-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}-4-[(2S)-4,4,4-trifluoro-3,3-dimethyl-2-(2,2,2-trifluoroacetamido)butanoyl]-4-azatricyclo[5.2.1.0~2,6~]dec-8-ene-3-carboxamide (non-preferred name) × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2M NaCl, Sodium/Potassium Phosphate 6.2, and 18% PEG1000	Resolution 1.86 Å R-free 0.239
9XG7 The crystal structure of MERS-CoV Main protease in complex with inhibitor FD2-21 Deposited 2025-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3248–3551（304 aa） Chain B 3248–3551（304 aa）	Not recorded	A1EZ7 7-(5-azanylpyridin-3-yl)-2-(2-chlorophenyl)-5,7-diazaspiro[3.4]octane-6,8-dione × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；0.05 M Magnesium chloride hexahydrate, 0.1 M HEPES pH 7.5, 30% v/v Polyethylene glycol monomethyl ether 550	Resolution 2.53 Å R-free 0.298
9XG7 The crystal structure of MERS-CoV Main protease in complex with inhibitor FD2-21 Deposited 2025-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 3248–3551（304 aa） Chain D 3248–3551（304 aa）	Not recorded	A1EZ7 7-(5-azanylpyridin-3-yl)-2-(2-chlorophenyl)-5,7-diazaspiro[3.4]octane-6,8-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；0.05 M Magnesium chloride hexahydrate, 0.1 M HEPES pH 7.5, 30% v/v Polyethylene glycol monomethyl ether 550	Resolution 2.53 Å R-free 0.298
9Y8W MERS Mpro with EGT710 Deposited 2025-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3248–3553（306 aa） Chain C 3248–3553（306 aa）	Not recorded	A1CBU (4S)-4-(iminomethyl)-3-(isoquinolin-4-yl)-1-[6-(trifluoromethyl)pyridin-3-yl]imidazolidin-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1M Hepes pH 7.5, 8% Ethylene Glycol, 10% Peg 8000	Resolution 3.04 Å R-free 0.278
9Y8W MERS Mpro with EGT710 Deposited 2025-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 3248–3553（306 aa） Chain D 3248–3553（306 aa）	Not recorded	A1CBU (4S)-4-(iminomethyl)-3-(isoquinolin-4-yl)-1-[6-(trifluoromethyl)pyridin-3-yl]imidazolidin-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1M Hepes pH 7.5, 8% Ethylene Glycol, 10% Peg 8000	Resolution 3.04 Å R-free 0.278
9YCK Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P15 RNA, monomeric form Deposited 2025-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 4238–4377（140 aa） Chain B 5909–6432（524 aa）	Mutation：E191A	ZN ZINC ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9YCM Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P14-U RNA Deposited 2025-09-19	Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 4238–4377（140 aa） Chain B 5909–6432（524 aa） Chain D 4238–4377（140 aa） Chain E 5909–6432（524 aa）	Mutation：E191A Mutation：E191A	ZN ZINC ION × 10 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
9YCN Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P14-A RNA Deposited 2025-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 4238–4377（140 aa） Chain B 5909–6432（524 aa）	Not recorded	ZN ZINC ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å
9YCO Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P14-G RNA Deposited 2025-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 4238–4377（140 aa） Chain B 5909–6432（524 aa）	Not recorded	ZN ZINC ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

11 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	R1AB_MERS1
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–140； UniProt 4238–4377 Author chain D； PDBConstruct 1–140； UniProt 4238–4377 Author chain B； PDBConstruct 1–524； UniProt 5909–6432 Author chain E； PDBConstruct 1–524； UniProt 5909–6432

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ycl
Deposition date deposition_date	2025-09-19
Structure title title	Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P15 RNA, dimeric form
Keywords keywords	MERS-CoV, exoribonuclease, proofreading, coronavirus, RNA, VIRAL PROTEIN, Viral Protein-RNA complex; Viral Protein/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	43.42 Å
Radius of gyration Rg (electron density) rg_electron	44.02 Å
Forward intensity I(0) i0	480827000.00
Molecular weight molecular_weight	162350.0 kDa
Excluded volume excluded_volume	195620 Å³
Envelope volume envelope_volume	285270 Å³
Hydration-shell volume shell_volume	57551 Å³
Envelope diameter envelope_diameter	164.6 Å
Shell Rg shell_rg	44.43 Å
Envelope Rg envelope_rg	44.78 Å
Shape Rg shape_rg	44.04 Å
Total Rg total_rg	43.97 Å
Total atoms total_atoms	11282
Residues n_residues	1334
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	156.2 Å
Rg (real space) rg_real	43.71 Å
Rg uncertainty (real space) rg_real_error	1.91 Å
I(0) (real space) i0_real	4.8080e+08
I(0) uncertainty (real space) i0_real_error	9.8650e+06
Rg (reciprocal space) rg_reciprocal	43.42 Å
I(0) (reciprocal space) i0_reciprocal	480700000.0000
Solution quality estimate total_estimate	0.6165
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	52.1 Å
Skewness Skewness skewness	0.591
Kurtosis Kurtosis kurtosis	0.347
Angular range angular_range	— – 0.1800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	29360000.0000
Real-space data points n_real_points	37
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.753; Stabil: 1.000; Sysdev: 0.032; Positv: 1.000; Valcen: 0.919; Smooth: 0.736

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Replicase polyprotein 1ab
Molecular weight formula_weight	14902.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	11282

AGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQAALPQ

来源 Source

来源生物 organism	Middle East respiratory syndrome-related coronavirus
NCBI Class编号 ncbi_taxonomy_id	1335626
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Guanine-N7 methyltransferase nsp14
Molecular weight formula_weight	59190.2 kDa
EC 编号 ec_number	2.1.1.56,3.1.13.-
Mutation mutation	E191A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

SQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYSRVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQMLSDTLDKLSDYCTFVCWAHGFALTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACWTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSCFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDDPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTRVHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIEDIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLWSTFTKVQ

来源 Source

来源生物 organism	Middle East respiratory syndrome-related coronavirus
NCBI Class编号 ncbi_taxonomy_id	1335626
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	T20P15 RNA
Molecular weight formula_weight	12478.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C,F

GGGAAUGAUUAGGCUAAUUAUUCGUAAUUAGCCUAAUCC

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	84344

fit	/app/data/saxs_computation/yc/9ycl/9ycl.fit
pddf	/app/data/pr_computation/yc/9ycl/9ycl.pr.out
profile	/app/data/saxs_computation/yc/9ycl/9ycl.dat

Cryo-EM structure of MERS-CoV nsp10-nsp14 (E191A) in complex with T20P15 RNA, dimeric form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replicase polyprotein 1ab

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)