The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBZ4",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Stable preparations of tyrosine hydroxylase provide the solution structure of the full-length enzyme.",
"publication": {
"title": "Stable preparations of tyrosine hydroxylase provide the solution structure of the full-length enzyme.",
"author_list": "Bezem MT, Baumann A, Skjærven L, Meyer R, Kursula P, Martinez A, Flydal MI",
"journal": "Sci Rep",
"doi": "10.1038/srep30390",
"pmid": "27462005",
"published_date": "2016 Jul 27"
},
"status": "released",
"submitted_date": "2016-06-25",
"released_date": "2018-01-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBZ4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBZ4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Tyrosine hydroxylase, isoform 1",
"short_name": "TYH",
"sequence": "MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREAAVAAAAAAV\r\nPSEPGDPLEAVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQR\r\nPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHLV\r\nTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLK\r\nGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFL\r\nASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASD\r\nEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQ\r\nPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLE\r\nGVQDELDTLAHALSAIG",
"organism": "Homo sapiens",
"uniprot_code": "P07101",
"uniprot_range_first": 1,
"uniprot_range_last": 497,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP\nRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR\nATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR\nQVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI\nAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI\nPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC\nHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG\nAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS\nRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG",
"mw": 55.611,
"total_mw": 222.445,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Na-HEPES 200 mM NaCl",
"concentration_unit": "mM",
"comment": null,
"additive": "200 mM NaCl",
"concentration": 20.0,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Tyrosine hydroxylase (Isoform 1, Homo sapiens)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "UiB",
"address": "Bergen, Norway",
"full_name": "University of Bergen",
"webpage": "http://www.uib.no"
}
],
"contributor_name": "Lars",
"contributor_surname": "Skjærven",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2015-06-14",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": 1.0,
"concentration_max": 3.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.027,
"s_max": 4.801,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ4_fit1_model1_img.png",
"software": "BUNCH",
"pdb_link": [
{
"pdb_code": "1toh",
"ext_code": "1TOH",
"ext_type": "pdb",
"difference_with_model": "derived"
},
{
"pdb_code": "2mda",
"ext_code": "2MDA",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ4_fit1_model1.pdb",
"model_mw": 222.8,
"bead_radius": 1.9,
"log": null,
"symmetry": "P222",
"comment": null,
"user": 134
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBZ4_fit1_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.55,
"p_value": 0.0,
"fit_residual_plot": "SASDBZ4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBZ4_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from solutions of tyrosine hydroxylase, isoform 1 in 20 mM Na-HEPES, 200 mM NaCl, pH 7.0 were collected on the P12 beam line of Petra-III (Hamburg, Germany) using a Pilatus 2M detector (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.124 nm). Different solute concentrations in the range 1.0-2.0 mg/ml were measured using an exposure time of 1 s (recorded as 20 x 0.050 s frames). The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering from the matched solvent-blank was subtracted. The data presented here are merged SAXS data derived from the solute concentration series.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 283.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 63330.0,
"pddf_i0_error": 219.0,
"guinier_i0": 62494.4,
"guinier_i0_error": 124.65,
"pddf_rg": 4.93,
"pddf_rg_error": 0.03,
"guinier_rg": 4.74,
"guinier_rg_error": 0.33,
"pddf_dmax": 20.0,
"pddf_dmax_error": null,
"porod_volume": 519.8,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 40,
"guinier_point_last": 95,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBZ4_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBZ4",
"status": "success",
"started_at": "2026-08-11T14:34:57.502341+00:00",
"finished_at": "2026-08-11T14:35:08.514327+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBZ4/",
"path": "/data/saxsdb/sasbdb/entries/z4/sasdbz4/source/summary.json",
"size": 8321,
"sha256": "d0b06e32f06c281a63c9b9a9109b6b6c82d2e65528cd5401e413cc1309acf87d"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBZ4.dat",
"path": "/data/saxsdb/sasbdb/entries/z4/sasdbz4/source/SASDBZ4.dat",
"size": 83852,
"sha256": "2d67a23684c10fcb7a1d97c427b8df1344b5954e2fba3062b382bcd1158e66a8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ4.out",
"path": "/data/saxsdb/sasbdb/entries/z4/sasdbz4/source/SASDBZ4.out",
"size": 148713,
"sha256": "8dfd61cd0845e057e53211a80ba408208da52fed018dbd9379d044434b2ecfa5",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ4.sascif",
"path": "/data/saxsdb/sasbdb/entries/z4/sasdbz4/source/SASDBZ4.sascif",
"size": 1738274,
"sha256": "671ea0bced71b6e990273601836f48ce0c74cdc765c5ce7c495751722033bc32",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBZ4.zip",
"path": "/data/saxsdb/sasbdb/entries/z4/sasdbz4/source/SASDBZ4.zip",
"size": 333774,
"sha256": "85f333efe6bd2d57b95155dad6fcdfe30e4afc175eaa0040bd49d5e2c33d5384",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
