Colicin N Translocation domain

{
  "code": "SASDC53",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "The Two-State Prehensile Tail of the Antibacterial Toxin Colicin N.",
    "publication": {
      "title": "The Two-State Prehensile Tail of the Antibacterial Toxin Colicin N.",
      "author_list": "Johnson CL, Solovyova AS, Hecht O, Macdonald C, Waller H, Grossmann JG, Moore GR, Lakey JH",
      "journal": "Biophys J",
      "doi": "10.1016/j.bpj.2017.08.030",
      "pmid": "29045862",
      "published_date": "2017 Oct 17"
    },
    "status": "released",
    "submitted_date": "2017-04-26",
    "released_date": "2017-10-25"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC53.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC53.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC53_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC53_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC53_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC53_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC53.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Colicin N Translocation domain",
          "short_name": "ColN-T",
          "sequence": "MGSNGADNAHNNAFGGGKNPGIGNTSGAGSNGSASSNRGNSNGWSWSNKPHKNDGFHSDGSYHITFHGDNNSKPKPGGNSGNRGNNGDGASSHHHHHH",
          "organism": "Escherichia coli",
          "uniprot_code": "P08083",
          "uniprot_range_first": 1,
          "uniprot_range_last": 90,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGSNGADNAHNNAFGGGKNPGIGNTSGAGSNGSASSNRGNSNGWSWSNKPHKNDGFHSDG\nSYHITFHGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLA\nKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQF\nLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSY\nNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEK\nIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGI\nMTISYLSSFIDANRVSNINNIISSVIR",
          "mw": 9.965,
          "total_mw": 9.965,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM Na-Phosphate 300 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.6,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Colicin N Translocation domain",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Newcastle, UK",
            "full_name": "Newcastle University",
            "webpage": "http://www.ncl.ac.uk"
          }
        ],
        "contributor_name": "Alex",
        "contributor_surname": "Solovyova",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2012-06-29",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 2.0,
    "number_of_frames": 10,
    "wavelength": 0.15,
    "sample_detector_distance": 2.85,
    "concentration_min": 0.4,
    "concentration_max": 6.3,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.032,
    "s_max": 4.548,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC53_fit1_model1_img.png",
          "software": "EOM/GAJOE",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDC53_fit1_model1.pdb",
          "model_mw": 10.04,
          "bead_radius": 1.9,
          "log": "https://www.sasbdb.org/media/log_files/GA003.log",
          "symmetry": "",
          "comment": "",
          "user": 213
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC53_fit1_model2_img.png",
          "software": "EOM/GAJOE",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDC53_fit1_model2.pdb",
          "model_mw": 9.949,
          "bead_radius": 1.9,
          "log": "https://www.sasbdb.org/media/log_files/GA003_9tEwzuh.log",
          "symmetry": "",
          "comment": "",
          "user": 213
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC53_fit1_fixed_fit_img.png",
      "software": "EOM/GAJOE",
      "chi_square_value": 1.5,
      "p_value": 0.000494,
      "fit_residual_plot": "fit4columns817_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC53_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/GA003.log",
      "software_version": "",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "The results obtained from the bayesapp estimation of distribution functions from small-angle scattering data (http://www.bayesapp.org/) are included in the full entry zip archive.",
  "experiment_description": "Synchrotron SAXS data from solutions of Colicin N Translocation domain in 50 mM Na-Phosphate 300 mM NaCl, pH 7.6 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.15 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 0.4 and 6.3 mg/ml were measured at 4°C. 10 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
  "tags": [
    "idp"
  ],
  "intensity_unit": null,
  "experimental_mw": 10.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": 18.5,
  "guinier_i0_mw_error": 0.88,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 23.4,
  "pddf_i0_error": 0.0777,
  "guinier_i0": 22.95,
  "guinier_i0_error": 0.044,
  "pddf_rg": 2.93,
  "pddf_rg_error": 0.02,
  "guinier_rg": 2.76,
  "guinier_rg_error": 0.15,
  "pddf_dmax": 11.42,
  "pddf_dmax_error": 0.25,
  "porod_volume": 21.82,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 53,
  "guinier_point_last": 110,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDC53_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-08-18T17:26:22.657806+02:00",
  "bragg_peak": []
}

{
  "code": "SASDC53",
  "status": "success",
  "started_at": "2026-08-11T13:52:35.522324+00:00",
  "finished_at": "2026-08-11T13:52:48.074412+00:00",
  "source_last_modified": "2021-08-18T17:26:22.657806+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC53/",
      "path": "/data/saxsdb/sasbdb/entries/53/sasdc53/source/summary.json",
      "size": 8186,
      "sha256": "616d75c18b09cf742eef8e0172c32543d8e57fd6df8209db37ce5dae85147b5d"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDC53.dat",
      "path": "/data/saxsdb/sasbdb/entries/53/sasdc53/source/SASDC53.dat",
      "size": 29979,
      "sha256": "2bd54ee084e4bc21f162fa4e7099e82b0ddcaf106e6756e6dec87646154c3df3",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDC53.out",
      "path": "/data/saxsdb/sasbdb/entries/53/sasdc53/source/SASDC53.out",
      "size": 87320,
      "sha256": "5768a725cf669af840728823e009be5507f6bd09d225e74c665cd399838f8f25",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC53.sascif",
      "path": "/data/saxsdb/sasbdb/entries/53/sasdc53/source/SASDC53.sascif",
      "size": 323000,
      "sha256": "08223ec2c6ac57397ca506e64558d8c9bc105a5e6c4663bcb7b096a888c68df4",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDC53.zip",
      "path": "/data/saxsdb/sasbdb/entries/53/sasdc53/source/SASDC53.zip",
      "size": 97632,
      "sha256": "e4f11ee9b00222fe25c8d2ef42a3b4cbd16c34482fe44f21b762b7dc5e6834ab",
      "role": "full_entry_zip",
      "zip_member_count": 8,
      "zip_validation": "central_directory_readable"
    }
  ]
}