The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC63",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural basis of apoptosis inhibition by the fowlpox virus protein FPV039.",
"publication": {
"title": "Structural basis of apoptosis inhibition by the fowlpox virus protein FPV039.",
"author_list": "Anasir MI, Caria S, Skinner MA, Kvansakul M",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.M116.768879",
"pmid": "28411240",
"published_date": "2017 Jun 2"
},
"status": "released",
"submitted_date": "2017-04-28",
"released_date": "2017-04-29"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC63.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC63_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC63_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC63_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC63.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Bcl-2-like protein FPV039",
"short_name": "FPV039",
"sequence": "MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKN",
"organism": "Fowlpox virus",
"uniprot_code": "Q9J5G4",
"uniprot_range_first": 1,
"uniprot_range_last": 143,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFD\nIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDA\nILSKYRSWFIDQDYWNGIRIYKNYSYIFNTASYCIFTASLIIASLAVFKICSFYM",
"mw": 16.823,
"total_mw": 16.823,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Uncharacterized protein (BAK1)",
"short_name": "Bak",
"sequence": "LGSTGSQVGRRLAIIGDDINKRYDAE",
"organism": "Gallus gallus",
"uniprot_code": "Q5F404",
"uniprot_range_first": 72,
"uniprot_range_last": 97,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MEGNEGDPPGAHRRRDSHGRRPSREINAEDQVAQETEEVFRSYTFYRYQQEREEGGAEVP\nMDPEIMEIQQELGSTGSQVGRRLAIIGDDINKRYDAEFRHMLKSLQPTKENAYEYFTTIA\nSSLFDSGINWGRVIALLGFGYCMAIHVYQQGITGFLRRIARYVTEFMLRNRIARWIAQQG\nGWVAALDLDNVYMKYMLVVLALVMVGHLVVRRFFRP",
"mw": 2.805,
"total_mw": 2.805,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM trisodium citrate pH, 200 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.0,
"deuteration": null
},
"purity_method": null,
"name": "Fowlpox Virus FPV039 antiapoptotic Bcl-2 viral protein in complex with BaK BH3 peptide (FPV039:BAK)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Sofia",
"contributor_surname": "Caria",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-10-02",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 30,
"wavelength": null,
"sample_detector_distance": 1.6,
"concentration_min": 0.31,
"concentration_max": 7.35,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.106,
"s_max": 6.185,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Fowlpox Virus FPV039 antiapoptotic Bcl-2 viral protein in complex with BaK BH3 peptide in 20 mM trisodium citrate, 200 mM NaCl, pH 6.0 were collected on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 1.6 m (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 0.31 to 7.35 mg/ml were measured. 30 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected were obtained from a single concentration scattering curve (7.35 mg/ml scattering data).",
"tags": [],
"intensity_unit": null,
"experimental_mw": 17.9,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 0.104031,
"guinier_i0_error": 0.0002,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 1.96,
"guinier_rg_error": 0.006,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 38,
"guinier_point_last": 70,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC63_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC63",
"status": "success",
"started_at": "2026-08-11T13:53:16.338675+00:00",
"finished_at": "2026-08-11T13:53:22.281354+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC63/",
"path": "/data/saxsdb/sasbdb/entries/63/sasdc63/source/summary.json",
"size": 7068,
"sha256": "c85b7156bc155934c526e336136295973a53865750925dd2dc017e46de17f614"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC63.dat",
"path": "/data/saxsdb/sasbdb/entries/63/sasdc63/source/SASDC63.dat",
"size": 44214,
"sha256": "b7d0d20815e2d232b6abb6b748758c1d7634d0d71d7a9e7783ae21530fdb7d32",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/63/sasdc63/source/SASDC63.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC63.sascif",
"path": "/data/saxsdb/sasbdb/entries/63/sasdc63/source/SASDC63.sascif",
"size": 49781,
"sha256": "b05b15f2feabc727a4344fa4c664bd4f0cf8925163fe2d770347289662ae1036",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC63.zip",
"path": "/data/saxsdb/sasbdb/entries/63/sasdc63/source/SASDC63.zip",
"size": 11486,
"sha256": "557af57e0fe0eae3e01eae6fc96acc46e1d47afb7224aaed0a47bb1885d69487",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
