The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCB9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.",
"publication": {
"title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.",
"author_list": "Cleveland TE 4th, He W, Evans AC, Fischer NO, Lau EY, Coleman MA, Butler P",
"journal": "Protein Sci",
"doi": "10.1002/pro.3365",
"pmid": "29266475",
"published_date": "2018 Mar"
},
"status": "released",
"submitted_date": "2017-11-21",
"released_date": "2018-01-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCB9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCB9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCB9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCB9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "640x640 mm 3He posn sensitive prop counter",
"name": "Ordela 2660N",
"resolution": 5.08
},
"name": "NIST Center for High Resolution Neutron Scattering (CHRNS)",
"city": "Gaithersburg, MD",
"country": "USA",
"beamline_name": "NG7",
"beam_geometry": null,
"type_of_source": "neutron source",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Apolipoprotein A-I",
"short_name": "ApoA-I",
"sequence": "MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ",
"organism": "Mus musculus",
"uniprot_code": "Q00623",
"uniprot_range_first": 67,
"uniprot_range_last": 264,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSS\nLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKV\nQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVD\nSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLM\nPMLETLKTQVQSVIDKASETLTAQ",
"mw": 25.153,
"total_mw": 50.306,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "1,2-dimyristoyl-d54-sn-glycero-3-phosphocholine",
"short_name": "d54-DMPC",
"sequence": "N/A",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "other",
"uniprot_sequence": null,
"mw": 0.732,
"total_mw": 99.0,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "PBS in D2O",
"concentration_unit": null,
"comment": "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Nanolipoprotein Particle (NLP) assembled with tail-deuterated DMPC - 100% D2O SANS",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "NIST",
"address": "Gaithersburg, MD, USA",
"full_name": "National Institute of Standards and Technology (NIST)",
"webpage": "https://www.nist.gov/"
}
],
"contributor_name": "Thomas",
"contributor_surname": "Cleveland",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-04-11",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 1800.0,
"number_of_frames": 2,
"wavelength": 0.6,
"sample_detector_distance": 4.0,
"concentration_min": null,
"concentration_max": 0.88,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.078,
"s_max": 5.936,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 600 + 600 = 1200 s total count time); 4 m (two frames of 1800 + 1800 = 3600 s total count time); 13 m (two frames of 600 + 600 = 1200 s total count time).",
"experiment_description": "Small-angle neutron scattering (SANS) data from solutions of Nanolipoprotein Particle (NLP) assembled with tail-deuterated DMPC in PBS constituted in 100% D2O, pD 7.4, were collected on the NG7 instrument at the NIST Center for Neutron Research (Gaithersburg, MD, USA) using a 640x640 mm 3He position sensitive Ordela 2660N detector at a wavelength of λ = 0.6 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 0.88 mg/ml was measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 148.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.0467,
"pddf_i0_error": 0.0013,
"guinier_i0": 0.048,
"guinier_i0_error": 0.0022,
"pddf_rg": 4.227,
"pddf_rg_error": 0.069,
"guinier_rg": 4.324,
"guinier_rg_error": 0.767,
"pddf_dmax": 10.7,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 22,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCB9_datloglog_img.png",
"symmetry": null,
"last_modified": "2022-08-15T15:12:53.046326+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCB9",
"status": "success",
"started_at": "2026-08-11T16:10:23.093924+00:00",
"finished_at": "2026-08-11T16:10:29.491866+00:00",
"source_last_modified": "2022-08-15T15:12:53.046326+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCB9/",
"path": "/data/saxsdb/sasbdb/entries/b9/sasdcb9/source/summary.json",
"size": 7534,
"sha256": "cdc8a1d791db0a1f98bae625aaf415aedb3536acd2d823bfbb62d7515941ae7f"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCB9.dat",
"path": "/data/saxsdb/sasbdb/entries/b9/sasdcb9/source/SASDCB9.dat",
"size": 7698,
"sha256": "7affeb7899d33cb798a2d9c1b8fe9bc4d8aac65dde77a8797bae15b674f9b04b",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCB9.out",
"path": "/data/saxsdb/sasbdb/entries/b9/sasdcb9/source/SASDCB9.out",
"size": 11113,
"sha256": "d0f200de7784218684c96137d3888f082bccc2cedab7adcabde3aae8fefb1b18",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCB9.sascif",
"path": "/data/saxsdb/sasbdb/entries/b9/sasdcb9/source/SASDCB9.sascif",
"size": 22551,
"sha256": "d0b1b48fdc04467ee7d998cf73455cb6bcdbff9edcee0c59751deed1c8d2056d",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCB9.zip",
"path": "/data/saxsdb/sasbdb/entries/b9/sasdcb9/source/SASDCB9.zip",
"size": 4946,
"sha256": "6471cd415eb58fb99008705350643b7faed5a49264b010b1815b10cb46f11a99",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
