Human stress-inducible heat shock 70 kDa protein 1, Hsp70 (Hspa1a) T204A mutant dimer, in the presence of ATP

{
  "code": "SASDDN6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Human stress-inducible Hsp70 has a high propensity to form ATP-dependent antiparallel dimers that are differentially regulated by co-chaperone binding.",
    "publication": {
      "title": "Human stress-inducible Hsp70 has a high propensity to form ATP-dependent antiparallel dimers that are differentially regulated by co-chaperone binding.",
      "author_list": "Trcka F, Durech M, Vankova P, Chmelik J, Martinkova V, Hausner J, Kadek A, Marcoux J, Klumpler T, Vojtesek B, Muller P, Man P",
      "journal": "Mol Cell Proteomics",
      "doi": "10.1074/mcp.RA118.001044",
      "pmid": "30459217",
      "published_date": "2018 Nov 20"
    },
    "status": "released",
    "submitted_date": "2018-05-17",
    "released_date": "2018-11-30"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDN6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDN6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDN6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDN6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "CEITEC",
      "city": "Brno",
      "country": "Czech Republic",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": "",
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Heat shock 70 kDa protein 1",
          "short_name": "HSPA1A_T204A",
          "sequence": "MSYYHHHHHHLESTSLYKKAGFGSENLYFQSMAKAAAIGI\r\nDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER\r\nLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKH\r\nWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKE\r\nIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV\r\nLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGAFDVSI\r\nLTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKH\r\nKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFE\r\nGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKA\r\nQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAV\r\nAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGV\r\nMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAM\r\nTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVT\r\nATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAED\r\nEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKK\r\nVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISG\r\nLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD",
          "organism": "Homo sapiens",
          "uniprot_code": "P0DMV8",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA\nLNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS\nSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA\nIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH\nFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA\nRFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN\nKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI\nPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI\nDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN\nALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE\nQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD",
          "mw": 73.74,
          "total_mw": 147.48,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50mM HEPES, 150mM KCH3COO, 2mM MgCl2",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Human stress-inducible heat shock 70 kDa protein 1, Hsp70 (Hspa1a) T204A mutant dimer, in the presence of ATP",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
            "webpage": "https://www.ceitec.eu/"
          }
        ],
        "contributor_name": "Tomas",
        "contributor_surname": "Klumpler",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-02-20",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 3600.0,
    "number_of_frames": null,
    "wavelength": 0.154,
    "sample_detector_distance": 0.48,
    "concentration_min": null,
    "concentration_max": 2.5,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.138,
    "s_max": 6.314,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDN6_fit1_model1_img.png",
          "software": "MODELLER",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDDN6_fit1_model1.pdb",
          "model_mw": 148.5,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 195
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDN6_fit1_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.15,
      "p_value": 0.489949,
      "fit_residual_plot": "SASDDN6_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDN6_fit1.fit",
      "fit_log": null,
      "software_version": "2.8.3",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of human stress-induced heat shock 70 kDa protein 1 ,Hsp70, (Hspa1a T204A mutant), with ATP in 50mM HEPES; 150mM KCH3COO; 2mM MgCl2, pH 7.5, were collected on a Rigaku BioSAXS-1000 instrument at CEITEC (Brno, Czech Republic) using a Pilatus 100K detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.154 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.50 mg/ml was measured at 4°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 148.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 155.0,
  "porod_mw_error": null,
  "pddf_i0": 0.7457,
  "pddf_i0_error": 0.0058,
  "guinier_i0": 0.76,
  "guinier_i0_error": 0.011,
  "pddf_rg": 3.97,
  "pddf_rg_error": 0.2,
  "guinier_rg": 4.01,
  "guinier_rg_error": 0.077,
  "pddf_dmax": 11.56,
  "pddf_dmax_error": null,
  "porod_volume": 248.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 2,
  "guinier_point_last": 14,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDN6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDN6",
  "status": "success",
  "started_at": "2026-08-11T15:13:01.844679+00:00",
  "finished_at": "2026-08-11T15:13:11.618171+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDN6/",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasddn6/source/summary.json",
      "size": 8522,
      "sha256": "bce938009595ac105757bd57da4366c48924e331b7cf07cadcf760f08ecbd3e6"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDN6.dat",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasddn6/source/SASDDN6.dat",
      "size": 13723,
      "sha256": "7a3734e94640af2aa0b5070df99da5670d4f0a1b2a0501c6b657c8fdc10a6a4c",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDN6.out",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasddn6/source/SASDDN6.out",
      "size": 16400,
      "sha256": "8d6a23019fae00b29fe2a42cb7277b4e2d9c85bc1527ff15cbda729d565f00bc",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDN6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasddn6/source/SASDDN6.sascif",
      "size": 1161405,
      "sha256": "eb5b93a33836ab78767053bdeb43dfd2fc51e3838513a2b5b6231487d7d67720",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDN6.zip",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasddn6/source/SASDDN6.zip",
      "size": 208609,
      "sha256": "5b1c9bd4d6b7735b706d097dc1ee561498b51f0b1c7e4fce0ea7488821ba389d",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}