The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVC5",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "The sequence–structure–function relationship of intrinsic ERα disorder",
"publication": {
"title": "The sequence–structure–function relationship of intrinsic ERα disorder",
"author_list": "Du Z, Wang H, Luo S, Yun Z, Wu C, Yang W, Buck M, Zheng W, Hansen A, Kao H, Yang S",
"journal": "Nature",
"doi": "10.1038/s41586-024-08400-1",
"pmid": null,
"published_date": "2025 Jan 08"
},
"status": "released",
"submitted_date": "2024-07-23",
"released_date": "2024-12-13"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVC5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVC5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVC5_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVC5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVC5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Duel detector",
"name": "Pilatus3 S 1M, Pilatus3 900 K",
"resolution": null
},
"name": "National Synchrotron Light Source II (NSLS-II)",
"city": "Upton, NY",
"country": "USA",
"beamline_name": "16-ID (LiX)",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Estrogen receptor",
"short_name": "ER-NTD",
"sequence": "SNAMTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRY",
"organism": "Homo sapiens",
"uniprot_code": "P03372",
"uniprot_range_first": 1,
"uniprot_range_last": 184,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY\nEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF\nLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK\nETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC\nRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR\nSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW\nAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG\nMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD\nKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL\nLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV",
"mw": 20.175,
"total_mw": 20.175,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM sodium phosphate, 50 mM NaCl, 0.05 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "SEC-SAXS data of phosphorylated estrogen receptor alpha (pSer118), N-terminal domain (NTD) at pH 7.4",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Cleveland, USA",
"full_name": "Case Western Reserve University",
"webpage": "https://case.edu/"
}
],
"contributor_name": "Sichun",
"contributor_surname": "Yang",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-07-17",
"storage_temperature": 8.0,
"cell_temperature": 4.0,
"exposure_time": 2.0,
"number_of_frames": 360,
"wavelength": 0.08189,
"sample_detector_distance": 4.003,
"concentration_min": null,
"concentration_max": 2.0,
"sample_volume": 100.0,
"flow_rate": 0.35,
"s_min": 0.1,
"s_max": 2.5,
"total_exposure_time": null,
"seccolumn": 54
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the phosphorylated N-terminal domain of estrogen receptor alpha (pSer118) in 20 mM sodium phosphate, 50 mM NaCl, 0.05 mM TCEP, pH 7.4 were collected on the 16-ID (LiX) beam line at the National Synchrotron Light Source II (NSLS-II; Upton, NY, USA) using a Pilatus3 S 1M, Pilatus3 900 K detector at a sample-detector distance of 4.0 m and at a wavelength of λ = 0.08189 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 100.00 μl sample at 2 mg/ml was injected at a 0.35 ml/min flow rate onto a Cytiva Superdex 75 Increase 5/150 column at 4°C. 360 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 20.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 43.0,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 3.83022,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 3.635,
"guinier_rg_error": 0.607,
"pddf_dmax": 16.0,
"pddf_dmax_error": null,
"porod_volume": 70.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 30,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVC5_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-01-08T17:59:15.079200+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDVC5",
"status": "success",
"started_at": "2026-08-11T14:45:15.525053+00:00",
"finished_at": "2026-08-11T14:45:20.800889+00:00",
"source_last_modified": "2025-01-08T17:59:15.079200+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVC5/",
"path": "/data/saxsdb/sasbdb/entries/c5/sasdvc5/source/summary.json",
"size": 6816,
"sha256": "56b36e9561d53e5bc66998ea9e35692eaa2c95f9b12efea33b03857d142d6aa7"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDVC5.dat",
"path": "/data/saxsdb/sasbdb/entries/c5/sasdvc5/source/SASDVC5.dat",
"size": 3167,
"sha256": "74a49952e3abb8cda18db05b5929407c83b166fddefc640dfd46037b019adc45",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/c5/sasdvc5/source/SASDVC5.out"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVC5.sascif",
"path": "/data/saxsdb/sasbdb/entries/c5/sasdvc5/source/SASDVC5.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDVC5.zip",
"path": "/data/saxsdb/sasbdb/entries/c5/sasdvc5/source/SASDVC5.zip",
"size": 987,
"sha256": "9732bbe465d93552c30684cd396fbf1f0386234f0f1d6a90eda34b0da421eafc",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
