SARS-CoV-2 N-protein (N1-245; amino acids 1-245): 167 µM

{
  "code": "SASDVU6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Dynamic ensembles of SARS-CoV-2 N-protein reveal head-to-head coiled-coil-driven oligomerization and phase separation.",
    "publication": {
      "title": "Dynamic ensembles of SARS-CoV-2 N-protein reveal head-to-head coiled-coil-driven oligomerization and phase separation.",
      "author_list": "Hernandez G, Martins ML, Fernandes NP, Veloso T, Lopes J, Gomes T, Cordeiro TN",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkaf502",
      "pmid": "40503686",
      "published_date": "2025 Jun 6"
    },
    "status": "released",
    "submitted_date": "2023-09-21",
    "released_date": "2025-02-10"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVU6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVU6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVU6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVU6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVU6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVU6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVU6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nucleoprotein",
          "short_name": "N1-245",
          "sequence": "GPMSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG\r\nKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG\r\nLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS\r\nQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ\r\nQQGQTWSHPQFEK",
          "organism": "Severe acute respiratory syndrome coronavirus 2",
          "uniprot_code": "P0DTC9",
          "uniprot_range_first": 1,
          "uniprot_range_last": 245,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG\nKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG\nLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS\nQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ\nQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH\nWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY\nKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA",
          "mw": 27.388,
          "total_mw": 54.776,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Strep(II)-tagged N-protein 1-245. The protein construct used for SAXS contains an additional two amino acids at the N-terminus (GP) as well as the VWSHPQFEK C-terminal tag."
        }
      ],
      "buffer": {
        "name": "100 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "SARS-CoV-2 N-protein (N1-245; amino acids 1-245): 167 µM",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Oeiras, Portugal",
            "full_name": "Instituto de Tecnologia Química e Biológica António Xavier, Universidade de Lisboa",
            "webpage": "http://www.itqb.unl.pt"
          }
        ],
        "contributor_name": "Guillem",
        "contributor_surname": "Hernandez",
        "orcid": "https://orcid.org/0000-0003-4438-5611"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-05-13",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 2.0,
    "number_of_frames": 10,
    "wavelength": 0.0954,
    "sample_detector_distance": 3.69,
    "concentration_min": null,
    "concentration_max": 4.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.045,
    "s_max": 3.4,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of SARS-CoV-2 N-protein (amino acids 1-245) in 100 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8 were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.0954 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 4.60 mg/ml was measured at 10°C. 10 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 54.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.4605,
  "pddf_i0_error": null,
  "guinier_i0": 0.466054,
  "guinier_i0_error": null,
  "pddf_rg": 5.2,
  "pddf_rg_error": 0.01,
  "guinier_rg": 5.17,
  "guinier_rg_error": 0.169,
  "pddf_dmax": 20.5,
  "pddf_dmax_error": 0.5,
  "porod_volume": 121.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 6,
  "guinier_point_last": 113,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDVU6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-06-16T15:30:57.949374+02:00",
  "bragg_peak": []
}

{
  "code": "SASDVU6",
  "status": "success",
  "started_at": "2026-08-11T16:52:51.112294+00:00",
  "finished_at": "2026-08-11T16:53:00.753574+00:00",
  "source_last_modified": "2025-06-16T15:30:57.949374+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVU6/",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasdvu6/source/summary.json",
      "size": 6870,
      "sha256": "dc1e303568a9eff591e6e4b449fbc437fb14b2cffef48ee78ffe33e84d091801"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDVU6.dat",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasdvu6/source/SASDVU6.dat",
      "size": 116328,
      "sha256": "d46ea32b784e412cc00f9d5238accaee6b178f8a53602fe3af3931f663844733",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDVU6.out",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasdvu6/source/SASDVU6.out",
      "size": 171549,
      "sha256": "1a5e31cef111ac613b57547eaee118bb17c28613159f2a26ea884df9c5334925",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVU6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasdvu6/source/SASDVU6.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDVU6.zip",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasdvu6/source/SASDVU6.zip",
      "size": 74776,
      "sha256": "89760eec82fa1fcd3c22eeafc34cfc252557eb5053747821b70133fa867bdf73",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}