SAXSdb — 10vc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated endonuclease Cas9

Geobacillus stearothermophilus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 543–650	Not recorded	Anti-CRISPR protein (AcrIIC1) × 1 （A0A2D0TCG3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 10VC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 543–650（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279

1 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0ABF7PG96_GEOSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–111； UniProt 543–650 Author chain C； PDBConstruct 4–111； UniProt 543–650 Author chain E； PDBConstruct 4–111； UniProt 543–650 Author chain G； PDBConstruct 4–111； UniProt 543–650 Author chain I； PDBConstruct 4–111； UniProt 543–650 Author chain K； PDBConstruct 4–111； UniProt 543–650

Anti-CRISPR protein (AcrIIC1)

Neisseria meningitidis

UniProt A0A2D0TCG3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 1–86	Not recorded	CRISPR-associated endonuclease Cas9 × 1 （A0ABF7PG96）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 10VC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
7X31 solution structure of an anti-CRISPR protein Deposited 2022-02-27	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–86（86 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 1 mM [U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-13C; U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-13C; U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 100% D2O \| 100% D2O	Resolution not provided
7X4B Crystal Structure of An Anti-CRISPR Protein Deposited 2022-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–86（86 aa） Chain B 1–86（86 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；289 K；1.8 M (NH4)2SO4, 0.1 M Bis-Tris pH6.5, 2% (v/v) polyethylene glycol monomethyl ether 550	Resolution 1.61 Å R-free 0.210
8IF0 NmeHNH-AcrIIC1 complex Deposited 2023-02-16	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Y 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Ammonium acetate, 0.1 M MES, pH 6.2, 26% PEG3350	Resolution 1.57 Å R-free 0.229

4 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A2D0TCG3_NEIME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–86； UniProt 1–86 Author chain D； PDBConstruct 1–86； UniProt 1–86 Author chain F； PDBConstruct 1–86； UniProt 1–86 Author chain H； PDBConstruct 1–86； UniProt 1–86 Author chain J； PDBConstruct 1–86； UniProt 1–86 Author chain L； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	10vc
Deposition date deposition_date	2026-02-10
最后修订 last_revision	2026-04-29
Structure title title	Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1
Keywords keywords	Nuclease, Cas9, Inhibitor, Anti-CRISPR, CRISPR, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.55 Å
Radius of gyration Rg (electron density) rg_electron	39.32 Å
Forward intensity I(0) i0	277250000.00
Molecular weight molecular_weight	134140.0 kDa
Excluded volume excluded_volume	167350 Å³
Envelope volume envelope_volume	230700 Å³
Hydration-shell volume shell_volume	49562 Å³
Envelope diameter envelope_diameter	141.6 Å
Shell Rg shell_rg	44.66 Å
Envelope Rg envelope_rg	38.13 Å
Shape Rg shape_rg	39.32 Å
Total Rg total_rg	39.64 Å
Total atoms total_atoms	9450
Residues n_residues	1159
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	130.7 Å
Rg (real space) rg_real	39.48 Å
Rg uncertainty (real space) rg_real_error	1.31 Å
I(0) (real space) i0_real	2.7720e+08
I(0) uncertainty (real space) i0_real_error	5.1440e+06
Rg (reciprocal space) rg_reciprocal	39.53 Å
I(0) (reciprocal space) i0_reciprocal	277300000.0000
Solution quality estimate total_estimate	0.8719
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	52.3 Å
Skewness Skewness skewness	0.243
Kurtosis Kurtosis kurtosis	-0.282
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12450000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.820; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.870

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	CRISPR-associated endonuclease Cas9
Molecular weight formula_weight	13078.8 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K
Atom count atom_count	10744

SGGTGHDIVKFKLWSEQNGRCAYSLQPIEIERLLEPGYVEVDHVIPYSRSLDDSYTNKVLVLTRENREKGNRIPAEYLGVGTERWQQFETFVLTNKQFSKKKRDRLLRLHY

来源 Source

来源生物 organism	Geobacillus stearothermophilus
NCBI Class编号 ncbi_taxonomy_id	1422
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Anti-CRISPR protein (AcrIIC1)
Molecular weight formula_weight	9637.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L

MANKTYKIGKNAGYDGCGLCLAAISENEAIKVKYLRDICPDYDGDDKAEDWLRWGTDSRVKAAALEMEQYAYTSVGMASCWEFVEL

来源 Source

来源生物 organism	Neisseria meningitidis
NCBI Class编号 ncbi_taxonomy_id	487
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1294

▶

8. Citations (1)

▶

Unit-cell length a length_a	83.529 Å
Unit-cell length b length_b	89.252 Å
Unit-cell length c length_c	86.940 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.65 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	1.790 Å
Low-resolution limit resolution_low	29.590 Å
R factor r_factor	0.1963
R_work r_work	0.1944
R_free r_free	0.2330

fit	/app/data/saxs_computation/0v/10vc/10vc.fit
pddf	/app/data/pr_computation/0v/10vc/10vc.pr.out
profile	/app/data/saxs_computation/0v/10vc/10vc.dat

Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated endonuclease Cas9

State in the Current Structure

Other States of the Same Protein in the Database

Anti-CRISPR protein (AcrIIC1)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)