SAXSdb — 7x4b

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anti-CRISPR protein (AcrIIC1)

Neisseria meningitidis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–86 Chain B； UniProt 1–86	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；289 K；1.8 M (NH4)2SO4, 0.1 M Bis-Tris pH6.5, 2% (v/v) polyethylene glycol monomethyl ether 550	Resolution 1.61 Å R-free 0.210

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7X4B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VB Crystal structure of GeoCas9 HNH domain bound to S78A mutant anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1–86（86 aa）	Mutation：S79A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M sodium malonate, 22.5% PEG 3350	Resolution 2.30 Å R-free 0.279
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
10VC Crystal structure of GeoCas9 HNH domain bound to anti-CRISPR AcrIIC1 Deposited 2026-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.2 M Sodium malonate pH 6.0, 20% w/v PEG 3,350	Resolution 1.79 Å R-free 0.233
7X31 solution structure of an anti-CRISPR protein Deposited 2022-02-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–86（86 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 1 mM [U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-13C; U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-13C; U-15N] protein, 20 mM TRIS, 100 mM sodium chloride, 100% D2O \| 100% D2O	Resolution not provided
8IF0 NmeHNH-AcrIIC1 complex Deposited 2023-02-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Y 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Ammonium acetate, 0.1 M MES, pH 6.2, 26% PEG3350	Resolution 1.57 Å R-free 0.229

4 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A2D0TCG3_NEIME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–86； UniProt 1–86 Author chain B； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7x4b
Deposition date deposition_date	2022-03-02
Structure title title	Crystal Structure of An Anti-CRISPR Protein
Keywords keywords	Anti-CRISPR, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.92 Å
Radius of gyration Rg (electron density) rg_electron	18.52 Å
Forward intensity I(0) i0	6190850.00
Molecular weight molecular_weight	17885.0 kDa
Excluded volume excluded_volume	22164 Å³
Envelope volume envelope_volume	26656 Å³
Hydration-shell volume shell_volume	12858 Å³
Envelope diameter envelope_diameter	62.6 Å
Shell Rg shell_rg	23.14 Å
Envelope Rg envelope_rg	18.60 Å
Shape Rg shape_rg	18.54 Å
Total Rg total_rg	19.20 Å
Total atoms total_atoms	1254
Residues n_residues	166
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	64.1 Å
Rg (real space) rg_real	19.01 Å
Rg uncertainty (real space) rg_real_error	0.50 Å
I(0) (real space) i0_real	6.1910e+06
I(0) uncertainty (real space) i0_real_error	8.0620e+04
Rg (reciprocal space) rg_reciprocal	19.00 Å
I(0) (reciprocal space) i0_reciprocal	6191000.0000
Solution quality estimate total_estimate	0.6411
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.7 Å
Skewness Skewness skewness	0.422
Kurtosis Kurtosis kurtosis	-0.448
Angular range angular_range	— – 0.4200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1240000.0000
Real-space data points n_real_points	73
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.799; Stabil: 1.000; Sysdev: 0.374; Positv: 1.000; Valcen: 0.812; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Anti-CRISPR protein (AcrIIC1)
Molecular weight formula_weight	9637.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1444

MANKTYKIGKNAGYDGCGLCLAAISENEAIKVKYLRDICPDYDGDDKAEDWLRWGTDSRVKAAALEMEQYAYTSVGMASCWEFVEL

来源 Source

来源生物 organism	Neisseria meningitidis
NCBI Class编号 ncbi_taxonomy_id	487
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	178

▶

8. Citations (1)

▶

Unit-cell length a length_a	82.710 Å
Unit-cell length b length_b	82.710 Å
Unit-cell length c length_c	34.422 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 42
Space-group number int_tables_number	77
Crystal system crystal_system	tetragonal

Resolution resolution	1.610 Å
Low-resolution limit resolution_low	29.240 Å
R factor r_factor	0.1981
R_work r_work	0.1975
R_free r_free	0.2101

fit	/app/data/saxs_computation/x4/7x4b/7x4b.fit
pddf	/app/data/pr_computation/x4/7x4b/7x4b.pr.out
profile	/app/data/saxs_computation/x4/7x4b/7x4b.dat

Crystal Structure of An Anti-CRISPR Protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anti-CRISPR protein (AcrIIC1)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction