← Back to search

12pb

Single particle cryo-EM structure of human MTCH2 (hyperactive mutant K25E Y235A V238D)

Method: ELECTRON MICROSCOPY D_max: 97.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	12pb
deposition_date	2026-04-14
title	Single particle cryo-EM structure of human MTCH2 (hyperactive mutant K25E Y235A V238D)
keywords	mitochondrial outer membrane insertase, SLC25 carrier fold, hydrophilic groove, membrane protein biogenesis, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	29.40 Å
rg_electron	28.96 Å
i0	32792100.00
molecular_weight	45077.0 kDa
excluded_volume	56739 Å³
envelope_volume	76098 Å³
shell_volume	23834 Å³
envelope_diameter	98.2 Å
shell_rg	33.68 Å
envelope_rg	28.11 Å
shape_rg	28.95 Å
total_rg	29.55 Å
total_atoms	3168
n_residues	410
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	97.1 Å
rg_real	29.61 Å
rg_real_error	0.82 Å
i0_real	3.2790e+07
i0_real_error	4.9840e+05
rg_reciprocal	29.52 Å
i0_reciprocal	32790000.0000
total_estimate	0.8492
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	25.2 Å
skewness	0.413
kurtosis	-0.666
angular_range	— – 0.2700 Å⁻¹
current_alpha	0.0000
highest_alpha	3332000.0000
n_real_points	55
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.802; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.743; Smooth: 0.886

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	UCP1 Nanobody
formula_weight	13913.5 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B
atom_count	3180

GQRQLVESGGGLVQPGGSLRLSCAASGRTSSTYTMGWFRQAPGKEREFVAAISWTGTPYYADSVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYYCAAARPGLFIFVSDYARTAKYDYWGKGTPVTV

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli BL21(DE3)

Entity 2 polymer

description	Mitochondrial carrier homolog 2,Mitochondrial brown fat uncoupling protein 1
formula_weight	33481.0 kDa
mutation	K25E,Y235A,V238D,L199V,A200Y,T226A
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A

MADAASQVLLGSGLTILSQPLMYVEVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSVYYLMKEAFVKNNILADDVPCHLVSQAVAGFFASMLTAPFDLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.100 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	3.10 Å
resolution_method	—
num_particles	612877

fit	/app/data/saxs_computation/2p/12pb/12pb.fit
pddf	/app/data/pr_computation/2p/12pb/12pb.pr.out
profile	/app/data/saxs_computation/2p/12pb/12pb.dat

Single particle cryo-EM structure of human MTCH2 (hyperactive mutant K25E Y235A V238D)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)