← Back to search

12oz

Single particle cryo-EM structure of human MTCH2 (hyperactive mutant F285N F286N)

Method: ELECTRON MICROSCOPY D_max: 98.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	12oz
deposition_date	2026-04-14
title	Single particle cryo-EM structure of human MTCH2 (hyperactive mutant F285N F286N)
keywords	mitochondrial outer membrane insertase, SLC25 carrier fold, hydrophilic groove, membrane protein biogenesis, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	29.65 Å
rg_electron	29.21 Å
i0	32798700.00
molecular_weight	45089.0 kDa
excluded_volume	56755 Å³
envelope_volume	77131 Å³
shell_volume	23872 Å³
envelope_diameter	97.4 Å
shell_rg	34.09 Å
envelope_rg	28.39 Å
shape_rg	29.20 Å
total_rg	29.80 Å
total_atoms	3168
n_residues	410
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	98.0 Å
rg_real	29.87 Å
rg_real_error	0.79 Å
i0_real	3.2800e+07
i0_real_error	4.4920e+05
rg_reciprocal	29.78 Å
i0_reciprocal	32800000.0000
total_estimate	0.8485
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.9 Å
skewness	0.406
kurtosis	-0.675
angular_range	— – 0.2650 Å⁻¹
current_alpha	0.0000
highest_alpha	2984000.0000
n_real_points	54
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.809; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.713; Smooth: 0.886

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	Mitochondrial carrier homolog 2,Mitochondrial brown fat uncoupling protein 1
formula_weight	33491.1 kDa
mutation	F285N,F286N,L199V,A200Y,T226A
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3180

MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSVYYLMKEAFVKNNILADDVPCHLVSQAVAGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLNNRKVPFGKTYCCDLKMLI

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 polymer

description	UCP1 Nanobody
formula_weight	13913.5 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

GQRQLVESGGGLVQPGGSLRLSCAASGRTSSTYTMGWFRQAPGKEREFVAAISWTGTPYYADSVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYYCAAARPGLFIFVSDYARTAKYDYWGKGTPVTV

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli BL21(DE3)

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.300 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	3.30 Å
resolution_method	—
num_particles	321419

fit	/app/data/saxs_computation/2o/12oz/12oz.fit
pddf	/app/data/pr_computation/2o/12oz/12oz.pr.out
profile	/app/data/saxs_computation/2o/12oz/12oz.dat

Single particle cryo-EM structure of human MTCH2 (hyperactive mutant F285N F286N)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)