← Back to search

13hr

Cryo-EM structure of Pseudomonas aeruginosa outer-membrane lipoprotein PA3214 bound to MCE protein PA3213 C-terminal peptide

Method: ELECTRON MICROSCOPY D_max: 113.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	13hr
deposition_date	2026-05-06
title	Cryo-EM structure of Pseudomonas aeruginosa outer-membrane lipoprotein PA3214 bound to MCE protein PA3213 C-terminal peptide
keywords	outer membrane lipoprotein, Pseudomonas aeruginosa, MCE system, LIPID TRANSPORT; LIPID TRANSPORT
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	39.89 Å
rg_electron	39.02 Å
i0	420898000.00
molecular_weight	163070.0 kDa
excluded_volume	203000 Å³
envelope_volume	311540 Å³
shell_volume	64279 Å³
envelope_diameter	112.3 Å
shell_rg	48.09 Å
envelope_rg	36.79 Å
shape_rg	39.04 Å
total_rg	39.53 Å
total_atoms	11520
n_residues	1480
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	113.7 Å
rg_real	39.63 Å
rg_real_error	0.58 Å
i0_real	4.2090e+08
i0_real_error	6.2740e+06
rg_reciprocal	39.89 Å
i0_reciprocal	421000000.0000
total_estimate	0.8963
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	62.5 Å
skewness	-0.132
kurtosis	-0.800
angular_range	— – 0.2000 Å⁻¹
current_alpha	0.0000
highest_alpha	243900000.0000
n_real_points	41
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.926; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.988; Smooth: 0.880

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	ABC-type transport auxiliary lipoprotein component domain-containing protein
formula_weight	23243.5 kDa
src_method	man
entity_count	8

Polymer

type	polypeptide(L)
strand_id	A,B,C,D,E,F,G,H
atom_count	11520

MRLALRPLRRLSLAAGLAALATLGACSILPEAQVLQVYLLPVHNPPASAAARPVDWSLRIARPRTSLVLESPRIAVRPHGDEISVYQGARWSDPAPSLLRDRLMQAFQADGRVRGLSSDDSNLQADFELGGDLRAFQTEYPNGQASALIRYDARLVRTDDKRVVASRRFEVSQPVDGKKVAAVVSAFGKAGDTLSAQVLDWTLRQASAQPAVQP

Source

organism	Pseudomonas aeruginosa PAO1
ncbi_taxonomy_id	208964
host_organism	Escherichia coli BL21(DE3)

Entity 2 polymer

description	Mce/MlaD domain-containing protein
formula_weight	33410.9 kDa
src_method	man
entity_count	8

Polymer

type	polypeptide(L)
strand_id	I,J,K,L,M,N,O,P

METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYDIVFNEAVSGLSQGSSVQYSGIKVGDVAFLRLDPKDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPASPMLEGKDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENTARISRTLDHLDQATGALSAERENVSAVMQQLAQASRQANAALAQASELMRSANGLLNEQGKGMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKTKEFTP

Source

organism	Pseudomonas aeruginosa PAO1
ncbi_taxonomy_id	208964
host_organism	Escherichia coli BL21(DE3)

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.700 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	2.70 Å
resolution_method	—
num_particles	378252

fit	/app/data/saxs_computation/3h/13hr/13hr.fit
pddf	/app/data/pr_computation/3h/13hr/13hr.pr.out
profile	/app/data/saxs_computation/3h/13hr/13hr.dat

Cryo-EM structure of Pseudomonas aeruginosa outer-membrane lipoprotein PA3214 bound to MCE protein PA3213 C-terminal peptide

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)