1a3r

FAB FRAGMENT (ANTIBODY 8F5) COMPLEXED WITH PEPTIDE FROM HUMAN RHINOVIRUS (SEROTYPE 2) VIRAL CAPSID PROTEIN VP2 (RESIDUES 156-170)

Method: X-RAY DIFFRACTION D_max: 82.6 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN RHINOVIRUS CAPSID PROTEIN VP2

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain P； UniProt 225–239	Fragment：RESIDUES 156 - 170 Non-standard monomer：Yes (specific site not provided by mmCIF)	IGG2A 8F5 FAB (LIGHT CHAIN) × 1 IGG2A 8F5 FAB (HEAVY CHAIN) × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.5；FAB-PEPTIDE COMPLEX WAS CRYSTALLIZED FROM 0.9 M SODIUM CITRATE, 25 MM SODIUM CHLORIDE, 50 MM TRIS-HCL, PH 7.75, pH 7.5	Resolution 2.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1A3R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CQQ TYPE 2 RHINOVIRUS 3C PROTEASE WITH AG7088 INHIBITOR Deposited 1999-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa）	Not recorded	AG7 4-{2-(4-FLUORO-BENZYL)-6-METHYL-5-[(5-METHYL-ISOXAZOLE-3-CARBONYL)-AMINO]-4-OXO-HEPTANOYLAMINO}-5-(2-OXO-PYRROLIDIN-3-YL)-PENTANOIC ACID ETHYL ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；286 K；20% PEG10K, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 13K	Resolution 1.85 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1FPN HUMAN RHINOVIRUS SEROTYPE 2 (HRV2) Deposited 2000-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；ammonium sulphate, potassium phosphate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.60 Å
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 60 CA CALCIUM ION × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 5 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 6 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
1V9U Human Rhinovirus 2 bound to a fragment of its cellular receptor protein Deposited 2004-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 150 PDB declaration: 150-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa） Chain 4 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 30 CA CALCIUM ION × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonim sulfate, sodium/potassium phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.295
2HRV 2A CYSTEINE PROTEINASE FROM HUMAN RHINOVIRUS 2 Deposited 1999-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 851–992（142 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.00	Resolution 1.95 Å R-free 0.250
2HRV 2A CYSTEINE PROTEINASE FROM HUMAN RHINOVIRUS 2 Deposited 1999-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 851–992（142 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.00	Resolution 1.95 Å R-free 0.250
2XYA Non-covalent inhibtors of rhinovirus 3C protease. Deposited 2010-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa）	Not recorded	7L4 2-PHENYLQUINOLIN-4-OL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.288
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 60 CA CALCIUM ION × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 5 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 6 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3DPR Human rhinovirus 2 bound to a concatamer of the VLDL receptor module V3 Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain A 568–856（289 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 60 CA CALCIUM ION × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；Ammonium sulphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.441
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-MERIC	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3TN9 X-ray structure of the HRV2 empty capsid (B-particle) Deposited 2011-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 45 PDB declaration: 45-meric	Chain 1 568–856（289 aa） Chain 2 70–330（261 aa） Chain 3 331–567（237 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium acetate pH 6.5 - 8.0, 5% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.265
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 60	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
3VDD Structure of HRV2 capsid complexed with antiviral compound BTA798 Deposited 2012-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 120 PDB declaration: 120-meric	Chain A 568–850（283 aa） Fragment：UNP residues 568-850 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567 Chain D 1–69（69 aa） Fragment：UNP residues 1-69	Not recorded	BT8 3-ethoxy-6-{2-[1-(6-methylpyridazin-3-yl)piperidin-4-yl]ethoxy}-1,2-benzoxazole × 30	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；298 K；0.4-0.7 M ammonium sulfate, pH 7.5, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.273
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
4L3B X-ray structure of the HRV2 A particle uncoating intermediate Deposited 2013-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 45 PDB declaration: 45-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 70–330（261 aa） Fragment：UNP residues 70-330 Chain C 331–567（237 aa） Fragment：UNP residues 331-567	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.5 M ammonium sulfate, 1 M sodium/potassium phosphate, 5% glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 6.50 Å R-free 0.320
5FX5 Novel inhibitors of human rhinovirus 3C protease Deposited 2016-02-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa） Fragment：3C PROTEASE, RESIDUES 1508-1687	Not recorded	GOL GLYCEROL × 2 PG4 TETRAETHYLENE GLYCOL × 1 PGE TRIETHYLENE GLYCOL × 1 HOV ethyl (4R)-4-[[(2S,3R)-1-[(2S)-3-methyl-2-[(5-methyl-1,2-oxazol-3-yl)carbonylamino]butanoyl]-3-phenyl-pyrrolidin-2-yl]carbonylamino]-5-[(3S)-2-oxidanylidenepyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions 30% PEG400, 100 MM TRIS-HCL PH 8.5, 200 MM MGCL2	Resolution 1.70 Å R-free 0.211
5FX6 Novel inhibitors of human rhinovirus 3C protease Deposited 2016-02-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa） Fragment：3C PROTEASE, RESIDUES 1508-1687	Not recorded	6OY ethyl (4R)-4-[[(2S,4S)-1-[(2S)-3-methyl-2-[(5-methyl-1,2-oxazol-3-yl)carbonylamino]butanoyl]-4-phenyl-pyrrolidin-2-yl]carbonylamino]-5-[(3S)-2-oxidanylidenepyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M CACL2, 0,1 M TRIS PH 8.5, 25% PEG4000	Resolution 1.45 Å R-free 0.186
6FFN Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease inhibitors Deposited 2018-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa）	Not recorded	D8K ~{N}-[(5~{S},8~{S},11~{S},15~{R})-8-[(4-fluorophenyl)methyl]-5-(hydroxymethyl)-2,7,10,14-tetrakis(oxidanylidene)-1,6,9,13-tetrazabicyclo[13.3.0]octadecan-11-yl]-5-methyl-1,2-oxazole-3-carboxamide × 1 SO4 SULFATE ION × 1 DMS DIMETHYL SULFOXIDE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；2.0 M Ammonium Sulfate 0.1 M Na Acetate, pH 4.5,	Resolution 1.75 Å R-free 0.170
6FFS Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease inhibitors Deposited 2018-01-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1508–1687（180 aa）	Not recorded	D8E ~{N}-[(2~{S},5~{S},14~{S})-2-[(4-fluorophenyl)methyl]-5-(hydroxymethyl)-9-methyl-3,8,15-tris(oxidanylidene)-1,4,9-triazacyclopentadec-14-yl]-5-methyl-1,2-oxazole-3-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；2.0 M Ammonium Sulfate 0.1 M Na Acetate, pH 4.5	Resolution 1.86 Å R-free 0.172
7ARA Rhinovirus A2 2A protease in complex with zVAM.fmk Deposited 2020-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 851–992（142 aa） Chain B 851–992（142 aa）	Not recorded	S7N (phenylmethyl) ~{N}-[(2~{R})-3-methyl-1-[[(2~{S})-1-[[(3~{S})-1-methylsulfanyl-4-oxidanylidene-pentan-3-yl]amino]-1-oxidanylidene-propan-2-yl]amino]-1-oxidanylidene-butan-2-yl]carbamate × 1 ZN ZINC ION × 2 S7Q (phenylmethyl) ~{N}-[(2~{S})-3-methyl-1-[[(2~{R})-1-[[(3~{R})-1-methylsulfanyl-4-oxidanylidene-pentan-3-yl]amino]-1-oxidanylidene-propan-2-yl]amino]-1-oxidanylidene-butan-2-yl]carbamate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；7.5 % PEG8000, 0.3 M KCNS, 5 % 2-methyl-2-butanol, 10 % glycerol, 10 mM b-mercaptoethanol and 50 mM sodium-potassium phosphate buffer pH 8.0	Resolution 2.24 Å R-free 0.257
8AY4 Human rhinovirus 2 virion in situ Deposited 2022-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain A 582–850（269 aa） Chain B 81–330（250 aa） Chain C 331–567（237 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8AY5 Human rhinovirus 2 empty particle in situ Deposited 2022-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 600–850（251 aa） Chain B 81–330（250 aa） Chain C 331–567（237 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9G0B Rhinovirus A2 uncoating intermediate revealing the natural pocket factor (pH 5.8 and 4 degrees Celsius) Deposited 2024-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 568–850（283 aa） Chain B 70–330（261 aa） Chain C 331–567（237 aa） Chain D 2–69（68 aa）	Not recorded	DAO LAURIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 5.8；0.1 M phosphate buffer, pH 5.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

17 other PDB entries and 48 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_HRV2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain P； PDBConstruct 1–15； UniProt 225–239

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1a3r
Deposition date deposition_date	1998-01-23
Structure title title	FAB FRAGMENT (ANTIBODY 8F5) COMPLEXED WITH PEPTIDE FROM HUMAN RHINOVIRUS (SEROTYPE 2) VIRAL CAPSID PROTEIN VP2 (RESIDUES 156-170)
Keywords keywords	;IMMUNOGLOBULIN, ANTIBODY, RHINOVIRUS, NEUTRALIZATION, CONTINUOUS EPITOPE, COMPLEX (IMMUNOGLOBULIN-VIRAL PEPTIDE), Viral protein-Immune system COMPLEX ;; Viral protein/Immune system
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.24 Å
Radius of gyration Rg (electron density) rg_electron	25.26 Å
Forward intensity I(0) i0	41554400.00
Molecular weight molecular_weight	49111.0 kDa
Excluded volume excluded_volume	61078 Å³
Envelope volume envelope_volume	76049 Å³
Hydration-shell volume shell_volume	25663 Å³
Envelope diameter envelope_diameter	86.6 Å
Shell Rg shell_rg	31.99 Å
Envelope Rg envelope_rg	24.84 Å
Shape Rg shape_rg	25.24 Å
Total Rg total_rg	26.09 Å
Total atoms total_atoms	3456
Residues n_residues	447
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	82.6 Å
Rg (real space) rg_real	26.26 Å
Rg uncertainty (real space) rg_real_error	0.64 Å
I(0) (real space) i0_real	4.1550e+07
I(0) uncertainty (real space) i0_real_error	6.5720e+05
Rg (reciprocal space) rg_reciprocal	26.26 Å
I(0) (reciprocal space) i0_reciprocal	41550000.0000
Solution quality estimate total_estimate	0.9079
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.5 Å
Skewness Skewness skewness	0.322
Kurtosis Kurtosis kurtosis	-0.494
Angular range angular_range	— – 0.3000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9390000.0000
Real-space data points n_real_points	61
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.949; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.976; Smooth: 0.976

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	IGG2A 8F5 FAB (LIGHT CHAIN)
Molecular weight formula_weight	24417.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L
Atom count atom_count	3669

DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Entity 2 Entity 2 polymer

Description description	IGG2A 8F5 FAB (HEAVY CHAIN)
Molecular weight formula_weight	23588.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Entity 3 Entity 3 polymer

Description description	HUMAN RHINOVIRUS CAPSID PROTEIN VP2
Molecular weight formula_weight	1710.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

VKAETRLNPDLQPTEX

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	213

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1a3rh1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1a3rh2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d1a3rl1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1a3rl2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (4 domains)

Domain ID domain_id	1a3rH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1a3rH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1a3rL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1a3rL02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (3)

▶

Unit-cell length a length_a	71.790 Å
Unit-cell length b length_b	76.320 Å
Unit-cell length c length_c	92.320 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1710
R_work r_work	0.1710
R_free r_free	—

fit	/app/data/saxs_computation/a3/1a3r/1a3r.fit
pddf	/app/data/pr_computation/a3/1a3r/1a3r.pr.out
profile	/app/data/saxs_computation/a3/1a3r/1a3r.dat

FAB FRAGMENT (ANTIBODY 8F5) COMPLEXED WITH PEPTIDE FROM HUMAN RHINOVIRUS (SEROTYPE 2) VIRAL CAPSID PROTEIN VP2 (RESIDUES 156-170)

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN RHINOVIRUS CAPSID PROTEIN VP2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (3)

9. Files and Curves (10)

Files (7)

Curves (3)