1cd3

PROCAPSID OF BACTERIOPHAGE PHIX174

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SCAFFOLDING PROTEIN GPD)

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 420	PROTEIN (CAPSID PROTEIN GPF) × 60 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 60 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 60 （P03633） water × 420	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 35	PROTEIN (CAPSID PROTEIN GPF) × 5 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 5 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 5 （P03633） water × 35	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 42	PROTEIN (CAPSID PROTEIN GPF) × 6 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 6 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 6 （P03633） water × 42	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 280	PROTEIN (CAPSID PROTEIN GPF) × 40 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 40 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 40 （P03633） water × 280	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VGD_BPPHX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–152； UniProt 1–151 Author chain 2； PDBConstruct 1–152； UniProt 1–151 Author chain 3； PDBConstruct 1–152； UniProt 1–151 Author chain 4； PDBConstruct 1–152； UniProt 1–151

PROTEIN (CAPSID PROTEIN GPF)

OrganismNot specified

UniProt P03641

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 420	PROTEIN (SCAFFOLDING PROTEIN GPD) × 240 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 60 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 60 （P03633） water × 420	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 35	PROTEIN (SCAFFOLDING PROTEIN GPD) × 20 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 5 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 5 （P03633） water × 35	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 42	PROTEIN (SCAFFOLDING PROTEIN GPD) × 24 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 6 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 6 （P03633） water × 42	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 280	PROTEIN (SCAFFOLDING PROTEIN GPD) × 160 （P69486） PROTEIN (SPIKE PROTEIN GPG) × 40 （P03643） PROTEIN (SCAFFOLDING PROTEIN GPB) × 40 （P03633） water × 280	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VGF_BPPHX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–426； UniProt 1–426

PROTEIN (SPIKE PROTEIN GPG)

OrganismNot specified

UniProt P03643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 420	PROTEIN (SCAFFOLDING PROTEIN GPD) × 240 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 60 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 60 （P03633） water × 420	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 35	PROTEIN (SCAFFOLDING PROTEIN GPD) × 20 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 5 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 5 （P03633） water × 35	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 42	PROTEIN (SCAFFOLDING PROTEIN GPD) × 24 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 6 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 6 （P03633） water × 42	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 1 （P03633） water × 7	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 280	PROTEIN (SCAFFOLDING PROTEIN GPD) × 160 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 40 （P03641） PROTEIN (SCAFFOLDING PROTEIN GPB) × 40 （P03633） water × 280	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VGG_BPPHX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–175； UniProt 1–175

PROTEIN (SCAFFOLDING PROTEIN GPB)

OrganismNot specified

UniProt P03633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 420	PROTEIN (SCAFFOLDING PROTEIN GPD) × 240 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 60 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 60 （P03643） water × 420	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） water × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 35	PROTEIN (SCAFFOLDING PROTEIN GPD) × 20 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 5 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 5 （P03643） water × 35	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 42	PROTEIN (SCAFFOLDING PROTEIN GPD) × 24 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 6 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 6 （P03643） water × 42	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 7	PROTEIN (SCAFFOLDING PROTEIN GPD) × 4 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 1 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 1 （P03643） water × 7	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 280	PROTEIN (SCAFFOLDING PROTEIN GPD) × 160 （P69486） PROTEIN (CAPSID PROTEIN GPF) × 40 （P03641） PROTEIN (SPIKE PROTEIN GPG) × 40 （P03643） water × 280	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VGB_BPPHX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–120； UniProt 1–120

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1cd3
Deposition date deposition_date	1999-03-05
Structure title title	PROCAPSID OF BACTERIOPHAGE PHIX174
Keywords keywords	COMPLEX (VIRUS CAPSID PROTEINS), BACTERIOPHAGE, PROCAPSID, SCAFFOLDING PROTEIN, CHAPERONE, Icosahedral virus, Virus; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1cd3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1cd3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1cd3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	138.90 Å
Total Rg	139.00 Å
Atom count	585300
Residues	73980
Excluded volume	10394000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1cd3__assembly_1__model_1`	420-MERIC （420）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1cd3__assembly_2__model_1`	heptameric （7）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`1cd3__assembly_3__model_1`	35-meric （35）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`1cd3__assembly_4__model_1`	42-meric （42）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`1cd3__assembly_5__model_1`	heptameric （7）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`1cd3__assembly_6__model_1`	280-meric （280）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	PROTEIN (SCAFFOLDING PROTEIN GPD)
Molecular weight formula_weight	16953.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4
Atom count atom_count	9851

MSQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM

Entity 2 Entity 2 polymer

Description description	PROTEIN (CAPSID PROTEIN GPF)
Molecular weight formula_weight	48407.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

SNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQWIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARFGFRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYRDVISSFGGKTSYDADNRPLLVMRSNLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS

Entity 3 Entity 3 polymer

Description description	PROTEIN (SPIKE PROTEIN GPG)
Molecular weight formula_weight	19061.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK

Entity 4 Entity 4 polymer

Description description	PROTEIN (SCAFFOLDING PROTEIN GPB)
Molecular weight formula_weight	13863.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MEQLTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	96

▼

6. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1cd31_
Class class	a — All alpha proteins
Fold Fold fold	a.84 — Scaffolding protein gpD of bacteriophage procapsid
Superfamily Superfamily superfamily	a.84.1 — Scaffolding protein gpD of bacteriophage procapsid
Family Family family	a.84.1.1 — Scaffolding protein gpD of bacteriophage procapsid

Domain ID domain_id	d1cd32_
Class class	a — All alpha proteins
Fold Fold fold	a.84 — Scaffolding protein gpD of bacteriophage procapsid
Superfamily Superfamily superfamily	a.84.1 — Scaffolding protein gpD of bacteriophage procapsid
Family Family family	a.84.1.1 — Scaffolding protein gpD of bacteriophage procapsid

Domain ID domain_id	d1cd33_
Class class	a — All alpha proteins
Fold Fold fold	a.84 — Scaffolding protein gpD of bacteriophage procapsid
Superfamily Superfamily superfamily	a.84.1 — Scaffolding protein gpD of bacteriophage procapsid
Family Family family	a.84.1.1 — Scaffolding protein gpD of bacteriophage procapsid

Domain ID domain_id	d1cd34_
Class class	a — All alpha proteins
Fold Fold fold	a.84 — Scaffolding protein gpD of bacteriophage procapsid
Superfamily Superfamily superfamily	a.84.1 — Scaffolding protein gpD of bacteriophage procapsid
Family Family family	a.84.1.1 — Scaffolding protein gpD of bacteriophage procapsid

Domain ID domain_id	d1cd3f_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.5 — ssDNA viruses
Family Family family	b.121.5.1 — Microviridae-like VP

Domain ID domain_id	d1cd3g_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.5 — ssDNA viruses
Family Family family	b.121.5.1 — Microviridae-like VP

CATH v4.4 (7 domains)

Domain ID domain_id	1cd3100
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1850 — Procapsid Of Bacteriophage Phix174, Chain 1
Homologous superfamily homologous superfamily	10 — Scaffold protein D

Domain ID domain_id	1cd3200
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1850 — Procapsid Of Bacteriophage Phix174, Chain 1
Homologous superfamily homologous superfamily	10 — Scaffold protein D

Domain ID domain_id	1cd3300
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1850 — Procapsid Of Bacteriophage Phix174, Chain 1
Homologous superfamily homologous superfamily	10 — Scaffold protein D

Domain ID domain_id	1cd3400
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1850 — Procapsid Of Bacteriophage Phix174, Chain 1
Homologous superfamily homologous superfamily	10 — Scaffold protein D

Domain ID domain_id	1cd3B00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1260 — Scaffolding protein gpD of bacteriophage procapsid fold
Homologous superfamily homologous superfamily	10 — Scaffolding protein gpD of bacteriophage procapsid

Domain ID domain_id	1cd3F00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	169 — Bacteriophage G4 Capsid Proteins Gpf, Gpg, Gpj, subunit 1
Homologous superfamily homologous superfamily	10 — Microviridae F protein

Domain ID domain_id	1cd3G00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

▶

7. Citations (7)

The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.

J.Mol.Biol. (1999)

PMID: 10329166 · DOI: 10.1006/jmbi.1999.2699 PRIMARY

Structure of a viral procapsid with molecular scaffolding.

Nature (1997)

PMID: 9305849 · DOI: 10.1038/38537

DNA packaging intermediates of bacteriophage phi X174.

Structure (1995)

PMID: 7613866 · DOI: 10.1016/s0969-2126(01)00167-8

Analysis of the single-stranded DNA bacteriophage phi X174, refined at a resolution of 3.0 A.

J.Mol.Biol. (1994)

PMID: 8158636 · DOI: 10.1006/jmbi.1994.1253

Atomic structure of single-stranded DNA bacteriophage phi X174 and its functional implications.

Nature (1992)

PMID: 1370343 · DOI: 10.1038/355137a0

The Bacteriophages

The Bacteriophages (The Viruses) (1988)

Nucleotide sequence of bacteriophage phi X174 DNA.

Nature (1977)

PMID: 870828 · DOI: 10.1038/265687a0

Unit-cell length a length_a	774.000 Å
Unit-cell length b length_b	774.000 Å
Unit-cell length c length_c	774.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	96

Space group space_group	I 21 3
Space-group number int_tables_number	199
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	8.000 Å
R factor r_factor	—
R_work r_work	0.2750
R_free r_free	—

PROCAPSID OF BACTERIOPHAGE PHIX174

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SCAFFOLDING PROTEIN GPD)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (CAPSID PROTEIN GPF)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (SPIKE PROTEIN GPG)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (SCAFFOLDING PROTEIN GPB)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1cd3__assembly_1__model_1

1cd3__assembly_1__model_1 | I(q)

1cd3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (6 domains)

CATH v4.4 (7 domains)

7. Citations (7)

PROCAPSID OF BACTERIOPHAGE PHIX174

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SCAFFOLDING PROTEIN GPD)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN (CAPSID PROTEIN GPF)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN (SPIKE PROTEIN GPG)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN (SCAFFOLDING PROTEIN GPB)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1cd3__assembly_1__model_1

1cd3__assembly_1__model_1 | I(q)

1cd3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (6 domains)

CATH v4.4 (7 domains)

7. Citations (7)